DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr51A

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster


Alignment Length:109 Identity:31/109 - (28%)
Similarity:51/109 - (46%) Gaps:22/109 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEY-DPHPQYKYAY 66
            :||:.:.:|:.|......|.|:                  :.|:.:..:..|:| :.:.||.:..
  Fly     2 YKFVLIASLLVALCMAAPPRQE------------------SEAERIEREEYEKYQNENAQYSFNS 48

  Fly    67 DVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGY-KRTVQYTAD 109
            .|.|.::....|:.|||:|..|||.||..  ||: ||.|:|.||
  Fly    49 SVDDKINDGQISRNEEREGGTVRGSYSYF--DGFVKRRVEYIAD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 21/49 (43%)
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:459790 21/49 (43%)

Return to query results.
Submit another query.