DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Lcp1

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_476619.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster


Alignment Length:155 Identity:35/155 - (22%)
Similarity:58/155 - (37%) Gaps:43/155 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYD 67
            |||:.:.|::..|.|.           |.|      |.::..::.|.|....:.|         |
  Fly     2 FKFVMICAVLGLAVAN-----------PPV------PHSLGRSEDVHADVLSQSD---------D 40

  Fly    68 VQ----DSLSGDSKSQVEERDGDV---VRGEYSLIDADGYKRTVQYTADPINGFNA----VVNRE 121
            |:    ||....|....:...||.   :.|.:..|..:|....|:|.|:. ||:..    :....
  Fly    41 VRADGFDSSLHTSNGIEQAASGDAHGNIHGNFGWISPEGEHVEVKYVANE-NGYQPSGAWIPTPP 104

  Fly   122 PLVKAVAVAPVVKTVAAPVAHYAAP 146
            |:.:|:|     :.||...:|..||
  Fly   105 PIPEAIA-----RAVAWLESHPPAP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 14/58 (24%)
Lcp1NP_476619.1 Chitin_bind_4 46..93 CDD:459790 12/47 (26%)

Return to query results.
Submit another query.