DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and LOC3290078

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_556645.2 Gene:LOC3290078 / 3290078 VectorBaseID:AGAMI1_011744 Length:141 Species:Anopheles gambiae


Alignment Length:65 Identity:33/65 - (50%)
Similarity:46/65 - (70%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVV 118
            ::|..:|:||:.|.|:|..:||.|||.|.||||||:|||::.:.||....|:|.||..|||.|:|
Mosquito    64 KDYYAYPKYKFEYGVKDYHTGDHKSQWEVRDGDVVKGEYTVQEPDGSMSVVKYHADGKNGFEAIV 128

  Fly   119  118
            Mosquito   129  128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 27/51 (53%)
LOC3290078XP_556645.2 None

Return to query results.
Submit another query.