DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr65Av

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:113 Identity:27/113 - (23%)
Similarity:42/113 - (37%) Gaps:26/113 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQD 70
            |..|||::...|.  |:....||  .:..|....:..                 ..|.:.|:..|
  Fly    11 ICAFALLSTIRAA--PLDDSQHA--TILRYDNDNIGT-----------------DGYNFGYETSD 54

  Fly    71 SLSGDSKSQVEERDGD----VVRGEYSLIDADGYKRTVQYTADPINGF 114
            .::...:::|:....|    .|||..|.:..||...|:.|.||. |||
  Fly    55 GVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIADE-NGF 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 16/55 (29%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 16/55 (29%)

Return to query results.
Submit another query.