DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr49Aa

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:152 Identity:32/152 - (21%)
Similarity:62/152 - (40%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPV-LAKAAEEYDPHPQYKY 64
            |.:..:.:.||:.:.:          .|.|.|.  .|||     .:|: :.:..:|.:....|||
  Fly     1 MQYTLLFIAALLLSLA----------QARPQVR--GQAP-----GEPIPIIRQEQEVNFDGSYKY 48

  Fly    65 AYDVQDSLSGDSKSQVE----ERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVK 125
            .|:..:.::.:.:..::    :..|.|.:|.:|....:|....:.|.||. |||....:..|   
  Fly    49 LYETGNGINAEEEGYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADE-NGFQPQGDHLP--- 109

  Fly   126 AVAVAPVVKTVAAPVAHYA-AP 146
              ...|:...:...:|:.| ||
  Fly   110 --TPPPIPPAIQKALAYLATAP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 13/55 (24%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 13/55 (24%)

Return to query results.
Submit another query.