DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:183 Identity:110/183 - (60%)
Similarity:123/183 - (67%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFFAVLALISAASAGVLPV--QQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYK 63
            |||||...||.::.||||..|:  .|||||||||||||.|||||  ||.|:.||.|||||||||:
  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAV--AQKVVVKAAEEYDPHPQYR 63

  Fly    64 FAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPL----- 123
            |:|.|.|.|:||:|.||||||||||.|||||||:||||||||||:||:|||||||||.||     
  Fly    64 FSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVA 128

  Fly   124 --DHVKT--------------------VVKTVAPVAVAAAP------IPVAYH 148
              ..|||                    |||||||||..|||      .|||::
  Fly   129 VAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 39/51 (76%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 39/51 (76%)

Return to query results.
Submit another query.