DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Ccp84Aa

DIOPT Version :8

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster

Alignment Length:183 Identity:110/183 - (60%)
Similarity:123/183 - (67%) Gaps:37/183 - (20%)


  Fly     1 MAFKFFAVLALISAASAGVLPV--QQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYK 63
            |||||...||.::.||||..|:  .|||||||||||||.|||||  ||.|:.||.|||||||||:
  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAV--AQKVVVKAAEEYDPHPQYR 63

  Fly    64 FAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPL----- 123
            |:|.|.|.|:||:|.||||||||||.|||||||:||||||||||:||:|||||||||.||     
  Fly    64 FSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVA 128

  Fly   124 --DHVKT--------------------VVKTVAPVAVAAAP------IPVAYH 148
              ..|||                    |||||||||..|||      .|||::
  Fly   129 VAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHY 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 39/51 (76%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130748678
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.