DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Ccp84Ac

DIOPT Version :8

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster

Alignment Length:154 Identity:79/154 - (51%)
Similarity:97/154 - (62%) Gaps:13/154 - (8%)


  Fly     1 MAFKFFAVLA-LISAASAGVLPVQ------QVYHA-APAVATYAQAPVAVAHAQPVLTKATEEYD 57
            ||||..|::: .::|.|||::||:      |:|.| .|....|.:......|...|...     |
  Fly     1 MAFKLVALVSCCLAAVSAGLIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPD-----D 60

  Fly    58 PHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVP 122
            |||:|.|||||||:||||||||||.||||||.|||||.|:||::|.|:||:|.||||||||:|.|
  Fly    61 PHPKYNFAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREP 125

  Fly   123 LDHVKTVVKTVAPVAVAAAPIPVA 146
            |.||...|...|||....||...|
  Fly   126 LAHVHHKVVAAAPVQYHHAPAAAA 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 39/51 (76%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130748841
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.