DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr76Ba

DIOPT Version :8

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster

Alignment Length:157 Identity:52/157 - (33%)
Similarity:71/157 - (45%) Gaps:41/157 - (26%)


  Fly    10 ALISAASAGVLP------------VQQVYHAAPA------VATYAQAPVAVAHA----------- 45
            ||:..|:|..:|            ..|.:|.||.      .|.:....|..||:           
  Fly    11 ALLGVAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKAHSWGTVQDHHHQQ 75

  Fly    46 -QPVLTKAT-------EEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKR 102
             .||....:       ||...||:|:|.|.|:|:.:||.|.|.|.||||.|.|.|::.::||..|
  Fly    76 WAPVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTR 140

  Fly   103 IVQYTSDPVNGFNAVVNRV----PLDH 125
            ||:||:|..|||.|.|..|    .|:|
  Fly   141 IVEYTADSHNGFQATVKHVGHASHLEH 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 26/51 (51%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.