DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr64Ac

DIOPT Version :8

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster

Alignment Length:139 Identity:63/139 - (45%)
Similarity:77/139 - (55%) Gaps:20/139 - (14%)


  Fly    12 ISAASAGVLPVQQVYHAAPAVATYA----QAPVAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSL 72
            ||.|:..:|....:.:||||: :||    .||||||.     ....|.|||:|||.|:|.|.|..
  Fly    44 ISYAAPKLLAAPAISYAAPAI-SYAPKVLAAPVAVAK-----VAVAEPYDPNPQYSFSYGVTDHH 102

  Fly    73 SGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVA 137
            :||||.|.|.....||||.|||.:.||..|.|.||:|.||||||||.:          |.||.||
  Fly   103 TGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEK----------KGVAAVA 157

  Fly   138 VAAAPIPVA 146
            :|...:.||
  Fly   158 IAKPALAVA 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 27/51 (53%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:278791 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.