DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:152 Identity:76/152 - (50%)
Similarity:94/152 - (61%) Gaps:17/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFFAVL-ALISAASAGVLP----VQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHP 60
            ||.|...|| ||::.:||.|:|    ....|.:.||:|..| ||:....|.|      |.|||:|
  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGLALPAYPSYPALAKVA-APLVAKVAGP------EPYDPNP 58

  Fly    61 QYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDH 125
            ||.|:|||.|..:||.|||.|.|.||||.|.||||::||.:|||:||:|||:||||||.|     
  Fly    59 QYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRR----- 118

  Fly   126 VKTVVKTVAPVAVAAAPIPVAY 147
            ...|||.|||||...||.|:.:
  Fly   119 EGAVVKAVAPVAKVLAPAPLLH 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 32/51 (63%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm50625
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.