DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr62Ba

DIOPT Version :8

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001137868.1 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster

Alignment Length:122 Identity:38/122 - (31%)
Similarity:52/122 - (42%) Gaps:20/122 - (16%)


  Fly    42 VAHAQPVLTKATEEYDP----HPQYKFAYDVQDSLSGDSKSQV-----EERDGDVVHGEYSLIDS 97
            :||.|.......|.|..    |.:.:..|..|..:| |..|:|     |:|.||.|.|.||.::.
  Fly    17 IAHTQRGPAGHIEFYSDYGRNHDEERLHYSHQYHIS-DVASRVHILHREQRHGDYVSGSYSHLEP 80

  Fly    98 DGYKRIVQYTSDPVN-GFNAVV------NRVPLDHVKTVVKTVAPVAVAAAPIPVAY 147
            .|:.|.|.|.....| ||.|||      :||   |.....::..|:...|...|||:
  Fly    81 SGHIRSVHYEVRGANRGFKAVVEQRTGNSRV---HQTLEFRSRQPIRALAIAEPVAF 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 19/57 (33%)
Cpr62BaNP_001137868.1 Chitin_bind_4 45..89 CDD:278791 17/44 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.