DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr62Ba

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster


Alignment Length:122 Identity:38/122 - (31%)
Similarity:52/122 - (42%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VAHAQPVLTKATEEYDP----HPQYKFAYDVQDSLSGDSKSQV-----EERDGDVVHGEYSLIDS 97
            :||.|.......|.|..    |.:.:..|..|..:| |..|:|     |:|.||.|.|.||.::.
  Fly    17 IAHTQRGPAGHIEFYSDYGRNHDEERLHYSHQYHIS-DVASRVHILHREQRHGDYVSGSYSHLEP 80

  Fly    98 DGYKRIVQYTSDPVN-GFNAVV------NRVPLDHVKTVVKTVAPVAVAAAPIPVAY 147
            .|:.|.|.|.....| ||.|||      :||   |.....::..|:...|...|||:
  Fly    81 SGHIRSVHYEVRGANRGFKAVVEQRTGNSRV---HQTLEFRSRQPIRALAIAEPVAF 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 19/57 (33%)
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 17/44 (39%)

Return to query results.
Submit another query.