DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr35B

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster


Alignment Length:143 Identity:52/143 - (36%)
Similarity:66/143 - (46%) Gaps:25/143 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTK-------------- 51
            ||.|||...||::.|:....|.....|       :.....|.:||...||.              
  Fly     1 MAQKFFIAFALLAIAAIRAAPFHGHEH-------HGHHGGATSHASVHLTSHDDHHEEHHGHHHD 58

  Fly    52 ---ATEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNG 113
               ..:.:|.|.:|.|.|.|:|..:||.|||.|.|.|..|.|.|.|||:||:||.|.||:|...|
  Fly    59 HHGHDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKG 123

  Fly   114 FNAVVNRVPL-DH 125
            |.|.|:|..| ||
  Fly   124 FEAHVHREKLHDH 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 27/51 (53%)
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:459790 27/51 (53%)

Return to query results.
Submit another query.