DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Crys

DIOPT Version :8

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001285854.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster

Alignment Length:80 Identity:46/80 - (57%)
Similarity:62/80 - (77%) Gaps:0/80 - (0%)


  Fly    45 AQPVLTKATEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSD 109
            |..:...:.|:||..|||.|||||:|||:||.|.|.|:||||:|.|:||||:.||.:|||:||:|
  Fly    60 ATTLAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTAD 124

  Fly   110 PVNGFNAVVNRVPLD 124
            .|:||||:|::..||
  Fly   125 DVSGFNAIVSKQRLD 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 33/51 (65%)
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49727
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.