DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr23B

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:239 Identity:73/239 - (30%)
Similarity:90/239 - (37%) Gaps:99/239 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFFAVLALI--------------------SAASAG--------------------------V 19
            ||.||||:|:|.                    ||:|:|                          |
  Fly     1 MAAKFFALLSLALLATSQAEYNYNEKEAKAANSASSSGEDFLSDYHTPSNNALNSEATPDGYDYV 65

  Fly    20 LPVQQVYHAAPAVAT-----YAQAPVAVAHAQPVL-------------------TKATEEYD--- 57
            .|.:..:.|....|:     ..|...:.|:|:.||                   |:..:|..   
  Fly    66 APARNQFTAGSRTASVQASNLLQNAASAANAESVLLPSPLPVLRHEQNSEVVSSTQQQQEQQTVQ 130

  Fly    58 ----------------------PHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGY 100
                                  |...|.|.|.|.|:.:||.|...|.|||.||.|.|||||.|||
  Fly   131 HQQSEPLVVSSVLRQHQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGY 195

  Fly   101 KRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVAVAAAPIP 144
            ||.|.||:|.|:||||||||||. .:|.|   |.|||..|.|.|
  Fly   196 KRTVTYTADDVHGFNAVVNRVPY-ALKAV---VVPVAQVAQPTP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 30/51 (59%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:459790 30/51 (59%)

Return to query results.
Submit another query.