| Sequence 1: | NP_649678.1 | Gene: | Ccp84Af / 40820 | FlyBaseID: | FBgn0004778 | Length: | 151 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_608718.1 | Gene: | Cpr23B / 33480 | FlyBaseID: | FBgn0031467 | Length: | 302 | Species: | Drosophila melanogaster | 
| Alignment Length: | 239 | Identity: | 73/239 - (30%) | 
|---|---|---|---|
| Similarity: | 90/239 - (37%) | Gaps: | 99/239 - (41%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     1 MAFKFFAVLALI--------------------SAASAG--------------------------V 19 
  Fly    20 LPVQQVYHAAPAVAT-----YAQAPVAVAHAQPVL-------------------TKATEEYD--- 57 
  Fly    58 ----------------------PHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGY 100 
  Fly   101 KRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVAVAAAPIP 144 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Ccp84Af | NP_649678.1 | Chitin_bind_4 | 62..114 | CDD:278791 | 30/51 (59%) | 
| Cpr23B | NP_608718.1 | Chitin_bind_4 | 157..209 | CDD:278791 | 30/51 (59%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1544103at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR12236 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.020 | |||||