DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr23B

DIOPT Version :8

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster

Alignment Length:239 Identity:73/239 - (30%)
Similarity:90/239 - (37%) Gaps:99/239 - (41%)


  Fly     1 MAFKFFAVLALI--------------------SAASAG--------------------------V 19
            ||.||||:|:|.                    ||:|:|                          |
  Fly     1 MAAKFFALLSLALLATSQAEYNYNEKEAKAANSASSSGEDFLSDYHTPSNNALNSEATPDGYDYV 65

  Fly    20 LPVQQVYHAAPAVAT-----YAQAPVAVAHAQPVL-------------------TKATEEYD--- 57
            .|.:..:.|....|:     ..|...:.|:|:.||                   |:..:|..   
  Fly    66 APARNQFTAGSRTASVQASNLLQNAASAANAESVLLPSPLPVLRHEQNSEVVSSTQQQQEQQTVQ 130

  Fly    58 ----------------------PHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGY 100
                                  |...|.|.|.|.|:.:||.|...|.|||.||.|.|||||.|||
  Fly   131 HQQSEPLVVSSVLRQHQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGY 195

  Fly   101 KRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVAVAAAPIP 144
            ||.|.||:|.|:||||||||||. .:|.|   |.|||..|.|.|
  Fly   196 KRTVTYTADDVHGFNAVVNRVPY-ALKAV---VVPVAQVAQPTP 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 30/51 (59%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.