DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr5C

DIOPT Version :8

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster

Alignment Length:151 Identity:116/151 - (76%)
Similarity:127/151 - (84%) Gaps:10/151 - (6%)


  Fly     1 MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATY-AQAPVAVAH--AQPVLTKATEEYDPHPQY 62
            |||||.|:||||:||||||||..|:||||| |||| |.||.||..  |||||.||.|||||||||
  Fly     1 MAFKFVALLALIAAASAGVLPAGQLYHAAP-VATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQY 64

  Fly    63 KFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVK 127
            |:||||||::||||||||||||||||.|||||:||||:||.||||:||:|||||||||.||  ||
  Fly    65 KYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPL--VK 127

  Fly   128 TVVKTVAPVAVAAAPIPVAYH 148
            |||||||||    ||:..|||
  Fly   128 TVVKTVAPV----APVYAAYH 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 42/51 (82%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 42/51 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130748750
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.