DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Ccp84Aa

DIOPT Version :8

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster

Alignment Length:225 Identity:114/226 (50%)
Similarity:133/226 (59%) Gaps:58/226 (26%)


  Fly     1 MAFKFTILFA-ACIAVASAGIIPAAAPL---------------AAVAQ------VEEYDPHPQYT 43
            |||||  :|| |.:||||||..|.|||.               .||||      .|||||||||.
  Fly     1 MAFKF--VFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVVKAAEEYDPHPQYR 63

  Fly    44 YGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVA 108
            :.|.|.|.::||:|.|||.|:||||:|:|||.|||||:|||.|||||||||||||.|||||.|||
  Fly    64 FSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVA 128

  Fly   109 AAPAAVVAAPAPVVRAAVAAPVVR-AAPLTTTYAA-----APAPLAYAAAP------APLA-YAA 160
            .         ||||: .|||||.: |||....|||     ..||:|:.|||      ||:| |||
  Fly   129 V---------APVVK-TVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAA 183

  Fly   161 PAP-VVKAAPLVAAGPAIVKTQFASPLISY 189
            ||. ...|||          |.:|:|.::|
  Fly   184 PAAYATYAAP----------THYAAPAVAY 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 35/52 (67%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130749208
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.