DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Ccp84Af

DIOPT Version :10

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:148 Identity:81/148 - (54%)
Similarity:96/148 - (64%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFTILFA--ACIAVASAGIIP--------------AAAPLA-AVAQ------VEEYDPHPQY 42
            |||||   ||  |.|:.||||::|              |.||:| |.||      .|||||||||
  Fly     1 MAFKF---FAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQY 62

  Fly    43 TYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPL---- 103
            .:.|||:|::|||||:|||.|:||||.|:|||.|:|||:|||.||:||:|||||||.|.||    
  Fly    63 KFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVK 127

  Fly   104 VAAVAAAPAAVVAAPAPV 121
            ......||.||.|||.||
  Fly   128 TVVKTVAPVAVAAAPIPV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:459790 34/51 (67%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 34/51 (67%)

Return to query results.
Submit another query.