DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr72Eb

DIOPT Version :9

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:215 Identity:54/215 - (25%)
Similarity:78/215 - (36%) Gaps:45/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CIAVASAGIIPAAAPLA--------AVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVV 68
            |:...:.|:...:..|.        .::|....|.|.||.|||    .....||.:..|.:| |:
  Fly     7 CLICTTIGLAVGSPTLEYGPPPTSDTISQYHHQDEHGQYAYGY----MAPLYSKHETRTVDG-VI 66

  Fly    69 QGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPAAVVAAPAPVVRAAVAAPV--- 130
            :|.:|..||:|..:.|||.|| ..||: |....|...|....| .|.|.....:.|...|.:   
  Fly    67 RGTFSHIDANGETQTVDYVAD-AEGFH-VTSNLPNQQANQETP-EVAALRTQHLEAHNQAKLRLA 128

  Fly   131 ----VRAAPLTTTYAAAPAPLAY-------------AAAPAPLAYAAPAPV-VKAAPLVAAGPAI 177
                |...|:..|...|.|.:|:             .|....|....|.|: |::.|:....|..
  Fly   129 GDYSVGPQPVRDTPEVAAAKVAFFKRFEAEKLRNKLLAEKKVLVIPNPTPIAVRSQPIYVYQPTT 193

  Fly   178 --------VKTQFASPLISY 189
                    .|||...|..:|
  Fly   194 TGFVYNYHTKTQAQVPSRNY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 19/51 (37%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.