DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr72Eb

DIOPT Version :8

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster

Alignment Length:216 Identity:54/217 (25%)
Similarity:78/217 (36%) Gaps:47/217 (22%)


  Fly    12 CIAVASAGIIPAAAPLA--------AVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGD-V 67
            |:...:.|:...:..|.        .::|....|.|.||.|||      .....::.|||..| |
  Fly     7 CLICTTIGLAVGSPTLEYGPPPTSDTISQYHHQDEHGQYAYGY------MAPLYSKHETRTVDGV 65

  Fly    68 VQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPAAVVAAPAPVVRAAVAAPV-- 130
            ::|.:|..||:|..:.|||.|| ..||: |....|...|....| .|.|.....:.|...|.:  
  Fly    66 IRGTFSHIDANGETQTVDYVAD-AEGFH-VTSNLPNQQANQETP-EVAALRTQHLEAHNQAKLRL 127

  Fly   131 -----VRAAPLTTTYAAAPAPLAY-------------AAAPAPLAYAAPAPV-VKAAPLVAAGPA 176
                 |...|:..|...|.|.:|:             .|....|....|.|: |::.|:....|.
  Fly   128 AGDYSVGPQPVRDTPEVAAAKVAFFKRFEAEKLRNKLLAEKKVLVIPNPTPIAVRSQPIYVYQPT 192

  Fly   177 I--------VKTQFASPLISY 189
            .        .|||...|..:|
  Fly   193 TTGFVYNYHTKTQAQVPSRNY 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 20/53 (38%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49358
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.