DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr66Cb

DIOPT Version :8

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster

Alignment Length:147 Identity:49/147 - (33%)
Similarity:65/147 - (44%) Gaps:47/147 - (31%)


  Fly     1 MAFKFTILFAA-CIAVA----------------------------------------SAGIIPAA 24
            ||||:.|..:| |:::|                                        ..|.:..|
  Fly     1 MAFKYLIFASALCLSLAYPLEHQYYEESHGYEHLAHHEPEPIHEYGHHQIERISLGEEHGHLEHA 65

  Fly    25 APLAAVAQVEEYDPH------PQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRI 83
            .|.....:...:|.|      |:|.:.|.|.|..:||.|:|.|||:||.|:|||||.:.||..|.
  Fly    66 EPHYETHESHGHDEHVDYYAPPKYAFKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRT 130

  Fly    84 VDYTADPINGFNAVVRR 100
            ||||||..|||||||.:
  Fly   131 VDYTADKHNGFNAVVHK 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 29/51 (57%)
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:278791 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49683
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.