DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and CG13670

DIOPT Version :9

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:98 Identity:36/98 - (36%)
Similarity:51/98 - (52%) Gaps:7/98 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFAACIAVASA-----GIIPAAAPLAAV--AQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREG 65
            :..||.||..:     |.:.....|..|  .:..:|...|:|::.|.|:|..:...:.:.|||.|
  Fly    62 MIGACAAVGYSYARFEGPVVGPEHLVTVHDGRTVDYVARPEYSFAYGVEDGKTRVLQNRKETRNG 126

  Fly    66 DVVQGQYSLNDADGYRRIVDYTADPINGFNAVV 98
            |.|:|.||:.|.||..|:|.||||..|||.|.|
  Fly   127 DEVRGVYSVVDPDGTLRVVKYTADDANGFQAEV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 23/51 (45%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:278791 23/51 (45%)
Paf1 <215..265 CDD:281915
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.