DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr64Ad

DIOPT Version :8

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster

Alignment Length:171 Identity:79/172 (46%)
Similarity:96/172 (56%) Gaps:40/172 (23%)


  Fly    10 AACIAVASAGI-----IPAAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQ 69
            ||.:|..:|.:     .|.|||:||....|..|.||||.:.|||:|.::||||||.|||:||||:
  Fly   109 AAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAHPQYKFAYDVQDTLTGDSKTQEETRDGDVVR 173

  Fly    70 GQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPAAVVAAPAPVVRAAVAAPVVRAA 134
            |.|||.:.||.||||.|.||.||||||||:::   ..||.||.      |||:...|||||    
  Fly   174 GSYSLIEPDGSRRIVSYYADSINGFNAVVQKD---VPVAVAPV------APVLAKTVAAPV---- 225

  Fly   135 PLTTTYAAAPAPLAYAAAPAPLAYAAPAPV---VKAAPLVA 172
                               ||:..||||||   ..|||:||
  Fly   226 -------------------APVVAAAPAPVFAKTLAAPIVA 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 34/52 (65%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:278791 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.