DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr64Ad

DIOPT Version :9

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster


Alignment Length:171 Identity:79/171 - (46%)
Similarity:96/171 - (56%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AACIAVASAGI-----IPAAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQ 69
            ||.:|..:|.:     .|.|||:||....|..|.||||.:.|||:|.::||||||.|||:||||:
  Fly   109 AAPVAPVAAPLAAPVAAPLAAPVAAPIATEIVDAHPQYKFAYDVQDTLTGDSKTQEETRDGDVVR 173

  Fly    70 GQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPAAVVAAPAPVVRAAVAAPVVRAA 134
            |.|||.:.||.||||.|.||.||||||||:::   ..||.||.      |||:...|||||    
  Fly   174 GSYSLIEPDGSRRIVSYYADSINGFNAVVQKD---VPVAVAPV------APVLAKTVAAPV---- 225

  Fly   135 PLTTTYAAAPAPLAYAAAPAPLAYAAPAPV---VKAAPLVA 172
                               ||:..||||||   ..|||:||
  Fly   226 -------------------APVVAAAPAPVFAKTLAAPIVA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 33/51 (65%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.