DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr64Aa

DIOPT Version :8

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster

Alignment Length:206 Identity:97/207 (47%)
Similarity:118/207 (57%) Gaps:37/207 (18%)


  Fly     1 MAFKFTILFAACIAVASAGIIP-----------------AAAPLAA-VAQVEEYDPHPQYTYGYD 47
            ||.|..::.:|.:||:||.::|                 .||||.| ||..|.|||:||||:.||
  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGLALPAYPSYPALAKVAAPLVAKVAGPEPYDPNPQYTFSYD 65

  Fly    48 VKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPA 112
            |.|..:||.|:|.|||.||||||.|||.:|||.||||:|||||::|||||||||          .
  Fly    66 VHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRRE----------G 120

  Fly   113 AVVAAPAPVVRAAVAAPVVRAAPLTTTYAAAPAPLAYAAAPAPLAYAAPAPVVKAAPLVAAGPAI 177
            |||.|.|||.:....||::.|:||     .|..| ||..|.|| ||.|.|.....|...|.|||:
  Fly   121 AVVKAVAPVAKVLAPAPLLHASPL-----VAKVP-AYGPALAP-AYPALAHGYGPALAPAYGPAL 178

  Fly   178 VKTQFASPLIS 188
            .|  .|.|.:|
  Fly   179 PK--LALPALS 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 35/52 (67%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.