DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr30B

DIOPT Version :8

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster

Alignment Length:191 Identity:62/192 (32%)
Similarity:87/192 (45%) Gaps:38/192 (20%)


  Fly     1 MAFKFTILFAACIAVASAGIIPAAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREG 65
            |..|.|.|...|:|.|...|...|.|        :|.| ..|.:.:.|.|..:||.|:|.|:|:.
  Fly     1 MMGKVTYLLCLCLASAVWAIELQAEP--------DYGP-VAYEFQWSVNDPHTGDIKSQKESRKD 56

  Fly    66 DVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPAAVVAAPAPVVRAAVAAPV 130
            |.|:|.|.|.|:|||||||.|.||..|||.|:|:|||....:     .:...|..::.|.:..||
  Fly    57 DKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKI-----PLPEPPKKLLAAKILTPV 116

  Fly   131 VRAAPLTTTYAAAPAPLAYAAAPAPLAYAAPAPVVKAAPLVAAGPAIVKTQFASPLISYAY 191
            :..|||                   :.||||..::|..  ::||..:   ..:.|...|.|
  Fly   117 LPVAPL-------------------VHYAAPKAIIKQE--LSAGNYV---SVSGPTAQYKY 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 27/52 (52%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50348
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.