DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: agt and mgmt

Sequence 1:NP_001303422.1 Gene:agt FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:XP_017950855.1 Gene:mgmt XenbaseID:XB-GENE-941688 Length:256 Species:Xenopus tropicalis

Alignment Length:82 Identity:37/83 (45%)
Similarity:47/83 (57%) Gaps:4/83 (5%)


  Fly   113 FQLSVWRALVH-MKRGETCTYSQLAERMGRPTAVRAVASAVAKNELAILIPCHRVVSQNGASKYH 176
            |..:|..||:. :|.|||.:|.:||...|...|||||..|:..|.:.||||||||:..||:...:
 Frog   170 FTKAVLMALLQKVKFGETVSYKELAVMAGNEKAVRAVGGAMRNNPVPILIPCHRVICSNGSVGNY 234

  Fly   177 WGA---ALKQLLLADEK 190
            .|.   .||..|||.||
 Frog   235 IGGKGNQLKPWLLAHEK 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 36/81 (44%)
ATase 111..189 CDD:294884 35/80 (44%)
mgmtXP_017950855.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110726705
eggNOG 1 0.900 E1_COG0350
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1573162at2759
OrthoFinder 1 1.000 FOG0003869
OrthoInspector 1 1.000 T1058584
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2186
TreeFam 1 0.960
76.830

Return to query results.
Submit another query.