DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment agt and MGMT

DIOPT Version :9

Sequence 1:NP_001303422.1 Gene:agt / 40816 FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_002403.3 Gene:MGMT / 4255 HGNCID:7059 Length:207 Species:Homo sapiens


Alignment Length:99 Identity:41/99 - (41%)
Similarity:54/99 - (54%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 ENSQAIPI-AIYGTDFQLS------VWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNE 156
            |..:..|: |::...||..      :|:.|..:|.||..:|.|||...|.|.|.|||..|:..|.
Human    74 EAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNP 138

  Fly   157 LAILIPCHRVVSQNGA-SKYHWGAALKQLLLADE 189
            :.|||||||||..:|| ..|..|.|:|:.|||.|
Human   139 VPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 41/99 (41%)
ATase 111..189 CDD:392118 37/84 (44%)
MGMTNP_002403.3 AdaB 7..173 CDD:223427 41/99 (41%)
ogt 93..172 CDD:273157 35/78 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155207
Domainoid 1 1.000 66 1.000 Domainoid score I9958
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3428
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573162at2759
OrthoFinder 1 1.000 - - FOG0004341
OrthoInspector 1 1.000 - - oto89765
orthoMCL 1 0.900 - - OOG6_101199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2186
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.