DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: agt and MGMT

Sequence 1:NP_001303422.1 Gene:agt FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_002403.3 Gene:MGMT HGNCID:7059 Length:207 Species:Homo sapiens

Alignment Length:99 Identity:41/100 (41%)
Similarity:54/100 (54%) Gaps:8/100 (8%)


  Fly    99 ENSQAIPI-AIYGTDFQLS------VWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNE 156
            |..:..|: |::...||..      :|:.|..:|.||..:|.|||...|.|.|.|||..|:..|.
Human    74 EAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNP 138

  Fly   157 LAILIPCHRVVSQNGA-SKYHWGAALKQLLLADE 189
            :.|||||||||..:|| ..|..|.|:|:.|||.|
Human   139 VPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHE 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 41/100 (41%)
ATase 111..189 CDD:294884 37/85 (44%)
MGMTNP_002403.3 Methyltransf_1N 6..90 CDD:308487 4/16 (25%)
ogt 93..172 CDD:273157 35/79 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110726824
eggNOG 1 0.900 E1_COG0350
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3428
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1573162at2759
OrthoFinder 1 1.000 FOG0003869
OrthoInspector 1 1.000 T1072495
orthoMCL 1 0.900 OOG5_127355
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2186
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.