DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: agt and atl1

Sequence 1:NP_001303422.1 Gene:agt FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_594858.1 Gene:atl1 PomBaseID:SPAC1250.04c Length:108 Species:Schizosaccharomyces pombe

Alignment Length:60 Identity:17/61 (28%)
Similarity:30/61 (49%) Gaps:0/61 (0%)


  Fly   112 DFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELAILIPCHRVVSQNG 171
            :|...|:.|:..:..|:..||.::|..:|.|:..|.|..|:........:|.|||::..|
pombe     5 EFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRG 64

Known Domains:


GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 17/61 (28%)
ATase 111..189 CDD:294884 17/61 (28%)
atl1NP_594858.1 Atl1 1..108 CDD:226219 17/61 (28%)
AdaB <5..87 CDD:223427 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003869
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2186
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.