DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: agt and Mgmt

Sequence 1:NP_001303422.1 Gene:agt FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_036993.1 Gene:Mgmt RGDID:3087 Length:209 Species:Rattus norvegicus

Alignment Length:98 Identity:38/99 (38%)
Similarity:54/99 (55%) Gaps:9/99 (9%)


  Fly   101 SQAIPI-AIYGTDFQLS------VWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELA 158
            ::.:|: |::...||..      :|:.|..:|.||..:|.|||...|.|.|.|||..|:..|.:.
  Rat    80 TEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGEMVSYQQLAALAGNPKAARAVGGAMRSNPVP 144

  Fly   159 ILIPCHRVVSQNGA-SKYHWGA-ALKQLLLADE 189
            ||||||||:..:|| ..|..|. .:|:.|||.|
  Rat   145 ILIPCHRVIRSDGAIGNYSGGGQTVKEWLLAHE 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 38/99 (38%)
ATase 111..189 CDD:294884 35/86 (41%)
MgmtNP_036993.1 AdaB 6..178 CDD:223427 38/99 (38%)
Methyltransf_1N 6..94 CDD:280944 3/14 (21%)
ogt 97..177 CDD:273157 33/80 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110726845
eggNOG 1 0.900 E1_COG0350
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1573162at2759
OrthoFinder 1 1.000 FOG0003869
OrthoInspector 1 1.000 T1086153
orthoMCL 1 0.900 OOG5_127355
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.700

Return to query results.
Submit another query.