DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: agt and agt-1

Sequence 1:NP_001303422.1 Gene:agt FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001041054.1 Gene:agt-1 WormBaseID:WBGene00000093 Length:175 Species:Caenorhabditis elegans

Alignment Length:80 Identity:39/81 (48%)
Similarity:53/81 (65%) Gaps:1/81 (1%)


  Fly   111 TDFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELAILIPCHRVVSQNG-ASK 174
            |.|.:.|:.|:..:.:|||.:||.:|..:|.|:||||||||.|:|.||.::|||||:...| .|.
 Worm    87 TAFGMQVYSAIQKIPKGETRSYSDIAREIGNPSAVRAVASACARNNLAYIVPCHRVIGSTGNLSG 151

  Fly   175 YHWGAALKQLLLADE 189
            |.||.|.|:.||..|
 Worm   152 YRWGIAKKRRLLQAE 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 39/81 (48%)
ATase 111..189 CDD:294884 38/79 (48%)
agt-1NP_001041054.1 AdaB <86..168 CDD:223427 39/81 (48%)
DNA_binding_1 92..167 CDD:279387 37/76 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140959696
eggNOG 1 0.900 E1_COG0350
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3428
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1573162at2759
OrthoFinder 1 1.000 FOG0003869
OrthoInspector 1 1.000 T474501
orthoMCL 1 0.900 OOG5_127355
Panther 1 1.100 LDO PTHR10815
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2186
TreeFam 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.