DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: agt and Mgmt

Sequence 1:NP_001303422.1 Gene:agt FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:XP_006507468.1 Gene:Mgmt MGIID:96977 Length:243 Species:Mus musculus

Alignment Length:98 Identity:40/99 (40%)
Similarity:57/99 (58%) Gaps:9/99 (9%)


  Fly   101 SQAIPI-AIYGTDFQLS------VWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELA 158
            ::.:|: |::...||..      :|:.|..:|.|||.:|.|||...|.|.|.|||..|:..|.:.
Mouse   112 TEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGETVSYQQLAALAGNPKAARAVGGAMRSNPVP 176

  Fly   159 ILIPCHRVVSQNGASKYH--WGAALKQLLLADE 189
            |||||||||..:||..::  .|.|:|:.|||.|
Mouse   177 ILIPCHRVVRSDGAIGHYSGGGQAVKEWLLAHE 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 40/99 (40%)
ATase 111..189 CDD:294884 37/86 (43%)
MgmtXP_006507468.1 AdaB 38..210 CDD:223427 40/99 (40%)
Methyltransf_1N 38..126 CDD:280944 3/14 (21%)
ogt 129..209 CDD:273157 35/80 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110726768
eggNOG 1 0.900 E1_COG0350
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3428
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003869
OrthoInspector 1 1.000 T1082561
orthoMCL 1 0.900 OOG5_127355
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2186
TreeFam 1 0.960
87.670

Return to query results.
Submit another query.