DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment agt and Mgmt

DIOPT Version :9

Sequence 1:NP_001303422.1 Gene:agt / 40816 FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:XP_006507468.1 Gene:Mgmt / 17314 MGIID:96977 Length:243 Species:Mus musculus


Alignment Length:98 Identity:40/98 - (40%)
Similarity:57/98 - (58%) Gaps:9/98 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SQAIPI-AIYGTDFQLS------VWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELA 158
            ::.:|: |::...||..      :|:.|..:|.|||.:|.|||...|.|.|.|||..|:..|.:.
Mouse   112 TEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGETVSYQQLAALAGNPKAARAVGGAMRSNPVP 176

  Fly   159 ILIPCHRVVSQNGASKYH--WGAALKQLLLADE 189
            |||||||||..:||..::  .|.|:|:.|||.|
Mouse   177 ILIPCHRVVRSDGAIGHYSGGGQAVKEWLLAHE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 40/98 (41%)
ATase 111..189 CDD:392118 37/85 (44%)
MgmtXP_006507468.1 AdaB 38..210 CDD:223427 40/98 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845678
Domainoid 1 1.000 66 1.000 Domainoid score I9964
eggNOG 1 0.900 - - E1_COG0350
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3428
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004341
OrthoInspector 1 1.000 - - oto93337
orthoMCL 1 0.900 - - OOG6_101199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2186
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.580

Return to query results.
Submit another query.