DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1137 and iqcd

Sequence 1:NP_649665.2 Gene:CG1137 FlyBaseID:FBgn0037454 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_021332131.1 Gene:iqcd ZFINID:ZDB-GENE-060526-200 Length:427 Species:Danio rerio

Alignment Length:387 Identity:82/388 (21%)
Similarity:172/388 (44%) Gaps:66/388 (17%)


  Fly    38 VLNVLAEAIERVKISLIMPKLLEHPAHMAKILNGTKYEKAVHLVESFVRRREFILREKRPPLM-- 100
            :|.||.|.|.:::.:.::|.||:    .::.|:.:..|:.|..::...:     |.||...:.  
Zfish    61 ILGVLDECIHQMETASLLPTLLK----SSEALSLSLEEEVVKALKEHQK-----LEEKYQSIALD 116

  Fly   101 ---DHGIIQ---------IIDFFQRNSRIYLLFPS---YYNHMSDN------EKKLLNAFEMLYD 144
               |...:|         :.|.|::..|:....|:   ....:..|      .:|:.|....|.:
Zfish   117 GNHDQNELQVEKAKSAKLVQDSFRKIIRLLRATPTTKVVLKRIEPNTTGEMGSQKIRNGLCELRE 181

  Fly   145 LAKDRLYRTSTDAIAQERQLHAMYKQNEVVKEQVEELRKKILDQKAAIRKSLADKEAYLQNYEDL 209
            :..:||..|..:.....:.:..:.:::...::.:|.|.|::.:..       .:|:|.:....:.
Zfish   182 VVLERLLTTPAEEKESRKMMLEVSQRHSANQKLIEALEKEVAEAN-------KNKDAEISTLNNK 239

  Fly   210 LMKKKREKNE----------RIQKEIDRCTRLVKANKKLSLERQADLEEQLQKTRNNYNLTTKNY 264
            :::.:|..::          |.|::.::.:.   :::|.|..::|.|:::..:.|...|...|..
Zfish   240 VLQLRRTLHQMGKGLEEFVMRTQQDAEKQSH---SDRKTSDGKRARLQQEASQLRTQLNNAIKAS 301

  Fly   265 LKQEKVFREEKNKLILQLQAIIKKYDHSIGEKMIENMELAEEHKKAKKALDEYMIGFLKVERVYK 329
            ..:|:..|:||.|...:::.:|:|||..||||..|..|:...|::.:..|.|....|..::..|.
Zfish   302 RGREQDLRKEKYKEETEIENLIQKYDAEIGEKQTELEEMTRMHEEDQMELTELEKRFDTLDLEYS 366

  Fly   330 QIVVKREE-EEARHRQHRVLLFAMNRAAIKIQKYWR------------KWKKHMRKKNRRNK 378
            ||:.:|:| :|.|.:|.|.... .::||..||.|||            |.||..:.|.::.|
Zfish   367 QIMEERQEAQELREQQERERQI-QSQAATVIQAYWRGFCVRKAKKVSAKPKKGKKGKGKKGK 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1137NP_649665.2 Smc <161..>375 CDD:224117 54/237 (23%)
iqcdXP_021332131.1 DUF3084 169..>401 CDD:331293 55/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5190
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007215
OrthoInspector 1 1.000 T597479
orthoMCL 1 0.900 OOG5_132126
Panther 1 1.100 O PTHR31598
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9920
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.