DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1137 and CG13168

Sequence 1:NP_649665.2 Gene:CG1137 FlyBaseID:FBgn0037454 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_995823.1 Gene:CG13168 FlyBaseID:FBgn0033705 Length:360 Species:Drosophila melanogaster

Alignment Length:353 Identity:150/354 (42%)
Similarity:227/354 (64%) Gaps:11/354 (3%)


  Fly    31 RIVQIGCVLNVLAEAIERVKISLIMPKLLEHPAHMAKILNGTKYEKAVHLVESFVRRREFIL--- 92
            |.|::..|..||..:.||:||::|:|||||:|..:..:|..|.||:.:..::..:|.    |   
  Fly     7 RQVRLEGVERVLKMSQERIKIAMIIPKLLENPEKLKSVLKDTCYEEVLEPIDDMIRH----LGKQ 67

  Fly    93 --REKRPPLMDHGIIQIIDFFQRNSRIYLLFPSYYNHMSDNEKKLLNAFEMLYDLAKDRLYRTST 155
              |.|.|  .||..::|:|||..|..|:..||....::::.:::||.||..|.:.|...|:|:|.
  Fly    68 SGRSKLP--HDHTTMRIVDFFLVNHSIHRFFPHLKKNLNERDRQLLAAFHFLLESAHVHLHRSSR 130

  Fly   156 DAIAQERQLHAMYKQNEVVKEQVEELRKKILDQKAAIRKSLADKEAYLQNYEDLLMKKKREKNER 220
            ..|.:||:|||::.||..:|::::||:..:..||...:...|.|..||...|:.|..||.:.|..
  Fly   131 SEITKERKLHAIFHQNVDIKKKIKELKASLAFQKVIGKWKTAAKGIYLMKVEEDLANKKWQNNVA 195

  Fly   221 IQKEIDRCTRLVKANKKLSLERQADLEEQLQKTRNNYNLTTKNYLKQEKVFREEKNKLILQLQAI 285
            ||.||::|.|.:::..|.|::||.:|||:||..|.:|...||.:|.:|...|.|||||:||||::
  Fly   196 IQNEIEKCHRTMRSYHKSSMDRQKELEEELQNARESYEKMTKKHLAEEHELRSEKNKLLLQLQSM 260

  Fly   286 IKKYDHSIGEKMIENMELAEEHKKAKKALDEYMIGFLKVERVYKQIVVKREEEEARHRQHRVLLF 350
            :||||.|:||||.||:...:::..|||.||::|:.:.:.||:||.|||||||||.|.:|.::::|
  Fly   261 LKKYDTSLGEKMRENLVAEDQYLAAKKVLDDFMVQYRQEERIYKNIVVKREEEERRVQQEKLVIF 325

  Fly   351 AMNRAAIKIQKYWRKWKKHMRKKNRRNK 378
            .|||||.|||||||||||..||:.|:.|
  Fly   326 MMNRAAGKIQKYWRKWKKDQRKRKRQGK 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1137NP_649665.2 Smc <161..>375 CDD:224117 103/214 (48%)
CG13168NP_995823.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141198101
eggNOG 1 0.900 E1_2FBB8
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5190
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007215
orthoMCL 1 0.900 OOG5_132126
Panther 1 1.100 P PTHR31598
RoundUp 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.