DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and TFIIIA

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001322779.1 Gene:TFIIIA AraportID:AT1G72050 Length:427 Species:Arabidopsis thaliana

Alignment Length:418 Identity:82/419 (20%)
Similarity:137/419 (33%) Gaps:136/419 (32%)


  Fly    23 LDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQF-REKALRKQMEIEE 86
            :|..|:..||:..::          ..:.::.|.:.:|:.|.:..:..|.. :......|||:||
plant    10 VDNKRDMAEEAKVDV----------KTSAKKDIRNYLCQYCGISRSKNYLITKHIQSHHQMELEE 64

  Fly    87 YCRELGLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGEE----EHQEEKGHEEYLEVDTSDQQ 147
            .       .:.:...:.||..|...|.|         .|.|    .|.::......||...:   
plant    65 E-------RDDEACEVDEESSSNHTCQE---------CGAEFKKPAHLKQHMQSHSLERSFT--- 110

  Fly   148 ECIGDTIEYLEDNYTIEMNSDQTEIVLESEKQY-----EETPSQQLALQ-----EAAKASLKARR 202
             |      |::|........|.....|.:.|..     :|....:.::|     ...|......|
plant   111 -C------YVDDCAASYRRKDHLNRHLLTHKGKLFKCPKENCKSEFSVQGNVGRHVKKYHSNDNR 168

  Fly   203 GRVRRGL------NSLTTSDGTEKGG-----------------------------------YICD 226
            .:...||      |:....|..||.|                                   .:|.
plant   169 DKDNTGLGDGDKDNTCKGDDDKEKSGSGGCEKENEGNGGSGKDNNGNGDSQPAECSTGQKQVVCK 233

  Fly   227 V--CGNFYEKRGRMMEHRRRH------------DGICQY------------------ACELCDAK 259
            .  ||..::...::.:|:..|            .|..:|                  .||:|.:|
plant   234 EIGCGKAFKYPSQLQKHQDSHVKLDSVEAFCSEPGCMKYFTNEECLKSHIRSCHQHINCEICGSK 298

  Fly   260 FQVREQLRKHMYSH-TGSKP--YKCSF--CSRQFFYESVLKSH-ENVHRGIKPYVCKV--CDKAF 316
             .:::.:::|:.:| ..|.|  .||..  ||..|...|.|:.| :.||..|:|:||..  |...|
plant   299 -HLKKNIKRHLRTHDEDSSPGEIKCEVEGCSSTFSKASNLQKHMKAVHDDIRPFVCGFPGCGMRF 362

  Fly   317 AYAHSLTKHELIHSDIKLYRC-DYCNKD 343
            ||.|...|||  :|...:|.| |:...|
plant   363 AYKHVRNKHE--NSGYHVYTCGDFVETD 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 13/65 (20%)
C2H2 Zn finger 225..245 CDD:275368 4/22 (18%)
COG5048 <250..369 CDD:227381 36/122 (30%)
C2H2 Zn finger 253..273 CDD:275368 5/20 (25%)
zf-H2C2_2 266..288 CDD:290200 8/27 (30%)
C2H2 Zn finger 281..301 CDD:275368 8/23 (35%)
zf-H2C2_2 294..318 CDD:290200 11/27 (41%)
C2H2 Zn finger 309..329 CDD:275368 9/22 (41%)
C2H2 Zn finger 337..353 CDD:275368 3/9 (33%)
TFIIIANP_001322779.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.