DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and ZNF732

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001131080.1 Gene:ZNF732 HGNCID:37138 Length:585 Species:Homo sapiens

Alignment Length:353 Identity:93/354 (26%)
Similarity:141/354 (40%) Gaps:64/354 (18%)


  Fly    26 IREEGEESPNEMLIQLLGVSYSNLND-REHIPDGI--------CKSCKVELNMAYQFREKALRKQ 81
            ||..||:...|     .|.|:...:| .:|  .||        |:.|..:......|.|..:...
Human   161 IRHTGEKHFKE-----CGKSFQKFSDLTQH--QGIHAGEKPYTCEECGKDFKWYLIFNEYEIIHT 218

  Fly    82 MEIEEYCRELGLLDESDVMMIK------EEDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEYLE 140
            .|....|.|.|.:..:.....|      |:....::|.:........|..:..|.|||       
Human   219 GEKPFTCEECGNIFTTSSNFAKHKVHTGEKSYKYEECGKAFNRSSTLTKHKRIHAEEK------- 276

  Fly   141 VDTSDQQECIGDTIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAK----ASLKAR 201
              ....:|| |..|       |...|..:.:.:...||.|:        .||..|    ::...:
Human   277 --PFTCEEC-GKII-------TSSSNVAKHKKIHTGEKLYK--------CQECGKVFNRSTTLTK 323

  Fly   202 RGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQL 266
            ..|:..|          || .|.|:.||..:.:...:.||:|.|.|...|.||.|...|:....|
Human   324 HNRIHTG----------EK-PYTCEECGKAFSRSSVLNEHKRIHTGEKPYKCEQCGKAFRQSATL 377

  Fly   267 RKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSD 331
            .||...|||.|||.|..|.:.|...:.|..|:.:|.|.:|:.|:.|.|||.::..|.||::||:.
Human   378 NKHKSIHTGEKPYTCEECGKAFSRFTTLNEHKRIHTGERPHKCEECGKAFGWSTDLNKHKIIHTG 442

  Fly   332 IKLYRCDYCNKDFRLLHHMRQHEETKLH 359
            .|.|:|:.|.|.|....::.:|:  |:|
Human   443 EKPYKCEECGKAFGWSAYLSKHK--KIH 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 16/70 (23%)
C2H2 Zn finger 225..245 CDD:275368 6/20 (30%)
COG5048 <250..369 CDD:227381 41/111 (37%)
C2H2 Zn finger 253..273 CDD:275368 7/20 (35%)
zf-H2C2_2 266..288 CDD:290200 11/22 (50%)
C2H2 Zn finger 281..301 CDD:275368 5/20 (25%)
zf-H2C2_2 294..318 CDD:290200 10/24 (42%)
C2H2 Zn finger 309..329 CDD:275368 9/20 (45%)
C2H2 Zn finger 337..353 CDD:275368 4/16 (25%)
ZNF732NP_001131080.1 KRAB 4..62 CDD:214630
KRAB 4..43 CDD:279668
COG5048 130..542 CDD:227381 93/354 (26%)
C2H2 Zn finger 143..163 CDD:275368 2/2 (100%)
C2H2 Zn finger 170..189 CDD:275368 7/26 (27%)
C2H2 Zn finger 225..244 CDD:275368 4/19 (21%)
C2H2 Zn finger 253..272 CDD:275368 2/19 (11%)
C2H2 Zn finger 280..300 CDD:275368 6/28 (21%)
zf-H2C2_2 292..317 CDD:290200 7/33 (21%)
C2H2 Zn finger 308..328 CDD:275368 4/20 (20%)
zf-H2C2_2 321..345 CDD:290200 8/35 (23%)
C2H2 Zn finger 336..356 CDD:275368 6/20 (30%)
zf-H2C2_2 349..373 CDD:290200 10/24 (42%)
C2H2 Zn finger 364..384 CDD:275368 7/20 (35%)
zf-H2C2_2 377..401 CDD:290200 12/24 (50%)
C2H2 Zn finger 392..412 CDD:275368 5/20 (25%)
zf-H2C2_2 405..427 CDD:290200 9/22 (41%)
C2H2 Zn finger 420..440 CDD:275368 9/20 (45%)
zf-H2C2_2 432..455 CDD:290200 10/23 (43%)
C2H2 Zn finger 448..468 CDD:275368 6/22 (27%)
zf-H2C2_2 460..483 CDD:290200 3/12 (25%)
C2H2 Zn finger 476..496 CDD:275368
zf-H2C2_2 488..511 CDD:290200
C2H2 Zn finger 504..524 CDD:275368
zf-H2C2_2 516..541 CDD:290200
C2H2 Zn finger 532..552 CDD:275368
C2H2 Zn finger 560..579 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.