DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and Zfp708

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001012325.2 Gene:Zfp708 MGIID:3040674 Length:541 Species:Mus musculus

Alignment Length:350 Identity:93/350 (27%)
Similarity:137/350 (39%) Gaps:81/350 (23%)


  Fly    62 SCKVELNMAYQFREKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEMYILEE---TT 123
            |.|.:.::|.....||.:        |:|.|...:.:.::|:.:   :....|..|..||   ..
Mouse    77 SVKRKASVAIHLGSKAHK--------CKECGKSFDRNSVLIQHQ---RIHTGERPYKCEECGMAF 130

  Fly   124 TGE---EEHQE-EKGHEEYLEVDTSDQQECIGDTIEYLEDNYTIEMNSDQTEIVLESEKQYE--- 181
            ||.   .:||. ..|.:.|      ..:|| |..       ::...|..|.:.:...||.|:   
Mouse   131 TGRCILSKHQRIHTGEKPY------KCKEC-GKA-------FSCSSNLHQHQQIHREEKPYKCDD 181

  Fly   182 -----------------ETPSQQLALQEAAKA-SLKAR---RGRVRRG----------------- 208
                             .|..:....:|..|| :..|.   ..|:..|                 
Mouse   182 CGKAFSCSSYLYKHQRIHTGMKPYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYS 246

  Fly   209 --LNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKHMY 271
              :|...|..|.:.  |.|..||..:.....:::|:|.|.|...||||.|...|.....|::|..
Mouse   247 TFMNHQRTHSGEKP--YECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKR 309

  Fly   272 SHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYR 336
            .|||.|||||..|.:.|.....|..|:.:|.|.|||.|:||.|||:::..|.||:.||:..|.||
Mouse   310 IHTGEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYR 374

  Fly   337 CDYCNKDFR----LLHHMRQHEETK 357
            |:.|.|.|.    |:.|.|.|...|
Mouse   375 CEECGKAFTNYSGLIVHRRVHTGEK 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 5/25 (20%)
C2H2 Zn finger 225..245 CDD:275368 5/20 (25%)
COG5048 <250..369 CDD:227381 48/112 (43%)
C2H2 Zn finger 253..273 CDD:275368 6/20 (30%)
zf-H2C2_2 266..288 CDD:290200 11/22 (50%)
C2H2 Zn finger 281..301 CDD:275368 5/20 (25%)
zf-H2C2_2 294..318 CDD:290200 13/24 (54%)
C2H2 Zn finger 309..329 CDD:275368 10/20 (50%)
C2H2 Zn finger 337..353 CDD:275368 7/20 (35%)
Zfp708NP_001012325.2 KRAB 17..77 CDD:214630 93/350 (27%)
KRAB 17..56 CDD:279668
C2H2 Zn finger 95..115 CDD:275368 4/23 (17%)
COG5048 119..540 CDD:227381 83/297 (28%)
C2H2 Zn finger 123..143 CDD:275368 6/20 (30%)
zf-H2C2_2 136..160 CDD:290200 7/38 (18%)
C2H2 Zn finger 151..171 CDD:275368 5/28 (18%)
C2H2 Zn finger 179..199 CDD:275368 0/20 (0%)
zf-H2C2_2 191..216 CDD:290200 4/25 (16%)
C2H2 Zn finger 207..227 CDD:275368 5/20 (25%)
zf-H2C2_2 219..243 CDD:290200 2/24 (8%)
C2H2 Zn finger 235..255 CDD:275368 2/20 (10%)
zf-H2C2_2 248..272 CDD:290200 7/26 (27%)
C2H2 Zn finger 263..283 CDD:275368 5/20 (25%)
zf-H2C2_2 275..300 CDD:290200 10/25 (40%)
C2H2 Zn finger 291..311 CDD:275368 6/20 (30%)
zf-H2C2_2 303..328 CDD:290200 12/25 (48%)
C2H2 Zn finger 319..339 CDD:275368 5/20 (25%)
zf-H2C2_2 331..355 CDD:290200 13/24 (54%)
C2H2 Zn finger 347..367 CDD:275368 10/20 (50%)
C2H2 Zn finger 375..395 CDD:275368 7/20 (35%)
zf-H2C2_2 388..411 CDD:290200 5/12 (42%)
C2H2 Zn finger 403..423 CDD:275368
zf-H2C2_2 415..439 CDD:290200
C2H2 Zn finger 431..451 CDD:275368
C2H2 Zn finger 459..479 CDD:275368
zf-H2C2_2 472..496 CDD:290200
C2H2 Zn finger 487..507 CDD:275368
C2H2 Zn finger 515..535 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.