DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and CG17806

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster

Alignment Length:425 Identity:99/426 (23%)
Similarity:171/426 (40%) Gaps:86/426 (20%)


  Fly    10 CRVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQFR 74
            ||.|..::|..:.|      .::...::|..:|.::...|.::..:|..||.||.::||.|..||
  Fly     5 CRTCGQEAEHAKSL------FDKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFR 63

  Fly    75 EKALR----------KQMEIE-EYCRELG---LLDESDVMMI---------------KEEDG--- 107
            |:.:|          ||.:.: |..||.|   |....|||.|               |:.||   
  Fly    64 ERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPL 128

  Fly   108 ---------------------SQQQCDEEMYILEETTTGEEEHQEEKGHEEYLEVDTSDQQECIG 151
                                 ...:|::.:.:..|.....:...|...|||    ..|:..:.:.
  Fly   129 KTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEE----PASEMPQVMK 189

  Fly   152 DTIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQE---AAKASLKARRGRVRRGLNSLT 213
            :....|:....::.|..:.    .|:...||.|.:.:|..|   :.....|..:...|....:..
  Fly   190 EEPRTLQVIGEVQKNRRKP----RSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAK 250

  Fly   214 TSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKHM-YSHTGSK 277
            .:...|...|.||.||..:.::|....|.|||.|..::.|:.||.....:..|..|: ..|.|..
  Fly   251 RAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIKHRGEL 315

  Fly   278 PYKCSFCSRQFFYESVLK--SHENVHRGI---KPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRC 337
            ||.|.:|.::|  ::.||  :||..|:..   :|:||..|.|||..:.:|..|.::|:..:.:.|
  Fly   316 PYVCKYCGKRF--DNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHC 378

  Fly   338 DYCNKDFRLLHHMRQHEETKLHQNAVMLAESMKVE 372
            :.|...|...:.:..|.::|.|:        :|||
  Fly   379 ELCQTFFNRRNALATHYKSKHHR--------LKVE 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 23/88 (26%)
C2H2 Zn finger 225..245 CDD:275368 8/20 (40%)
COG5048 <250..369 CDD:227381 33/125 (26%)
C2H2 Zn finger 253..273 CDD:275368 5/21 (24%)
zf-H2C2_2 266..288 CDD:290200 8/23 (35%)
C2H2 Zn finger 281..301 CDD:275368 7/22 (32%)
zf-H2C2_2 294..318 CDD:290200 12/29 (41%)
C2H2 Zn finger 309..329 CDD:275368 7/20 (35%)
C2H2 Zn finger 337..353 CDD:275368 3/16 (19%)
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 20/77 (26%)
zf-C2H2 260..282 CDD:278523 9/22 (41%)
C2H2 Zn finger 262..282 CDD:275368 8/20 (40%)
C2H2 Zn finger 290..311 CDD:275368 5/21 (24%)
COG5048 <298..>383 CDD:227381 26/87 (30%)
C2H2 Zn finger 319..339 CDD:275368 7/22 (32%)
C2H2 Zn finger 350..370 CDD:275368 7/20 (35%)
ZnF_U1 375..407 CDD:197732 9/40 (23%)
C2H2 Zn finger 378..396 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.