DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and CG14711

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster

Alignment Length:387 Identity:102/388 (26%)
Similarity:168/388 (43%) Gaps:58/388 (15%)


  Fly    10 CRVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQFR 74
            ||:||.:....:.:..:.::.:....|::.::..|....|...::||..:|.||...|..|::||
  Fly     7 CRICLTEDINSEAMAPLFDDNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVERLTSAHKFR 71

  Fly    75 EKALRKQMEIEEYCRELGLLDESD----VMMIKEEDGSQQQ-------CDEEMYILEETTTGEEE 128
            |                 |..||:    ..::|.|..|:..       .|...||.|......:.
  Fly    72 E-----------------LCQESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDG 119

  Fly   129 HQEEKGHEEYLEVDTSDQQECIGDTIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEA 193
            .:::.|.|..:|....|.   :|:|.:..|.: |:..:.|:.::::.:     .|.|....::..
  Fly   120 VEDDIGMENIMEEPLEDG---VGETSQAYETS-TVVDDLDEDDLLVPN-----STDSDYQPIERC 175

  Fly   194 AKASLK----ARRGRVR-RGLN----------------SLTTSDGTEKGGYICDVCGNFYEKRGR 237
            .||.::    .:|||.| ||.:                |..:|........:|::|||.|.||..
  Fly   176 RKAKVRKTRMTKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGNIYSKRAA 240

  Fly   238 MMEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHR 302
            :..|.|||.....:.||:|...|....:|.:|:..|||.||:.|.:|:|.|...|....||..|.
  Fly   241 LNIHMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHT 305

  Fly   303 GIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQHEETKLHQNAVM 364
            ..:|:.|..|.|||:|::.|..|.|.|:..|.:.|..|||.|...|.:.||..|..||..|:
  Fly   306 NERPFTCSTCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVI 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 17/77 (22%)
C2H2 Zn finger 225..245 CDD:275368 10/20 (50%)
COG5048 <250..369 CDD:227381 43/116 (37%)
C2H2 Zn finger 253..273 CDD:275368 6/20 (30%)
zf-H2C2_2 266..288 CDD:290200 10/22 (45%)
C2H2 Zn finger 281..301 CDD:275368 7/20 (35%)
zf-H2C2_2 294..318 CDD:290200 9/24 (38%)
C2H2 Zn finger 309..329 CDD:275368 9/20 (45%)
C2H2 Zn finger 337..353 CDD:275368 7/16 (44%)
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 20/91 (22%)
C2H2 Zn finger 228..248 CDD:275368 10/20 (50%)
zf-H2C2_2 240..264 CDD:290200 8/24 (33%)
COG5048 249..>362 CDD:227381 40/113 (35%)
C2H2 Zn finger 256..276 CDD:275368 6/20 (30%)
zf-H2C2_2 268..292 CDD:290200 11/24 (46%)
C2H2 Zn finger 284..304 CDD:275368 7/20 (35%)
zf-H2C2_2 299..321 CDD:290200 9/22 (41%)
C2H2 Zn finger 312..332 CDD:275368 9/20 (45%)
zf-H2C2_2 325..349 CDD:290200 10/24 (42%)
C2H2 Zn finger 340..362 CDD:275368 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3C1GA
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.