DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and CG31388

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster

Alignment Length:416 Identity:79/417 (19%)
Similarity:152/417 (36%) Gaps:87/417 (21%)


  Fly    10 CRVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQFR 74
            ||.|    .|:......:...:.|.:.:|.|:..::...|.:...:|..:|:.|:.:|.:|..||
  Fly     5 CRTC----SRMADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFR 65

  Fly    75 EKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQ-------QQCDEEMYILEETTTGEEE---- 128
            ...:..|..:|...|::.          |||:..:       ..|.:|:..|.......:.    
  Fly    66 RVCIEAQELLELQLRQVE----------KEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFI 120

  Fly   129 ---HQEEKGHEEYLEVDTSDQQECIGDTIEYLEDNYTIEMNSDQTEIVLESEKQYE--------- 181
               ..::|..:|...:.|:       .|.||:....::.......|:..:|:...|         
  Fly   121 FDPEPQDKNTDELASIKTT-------TTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPE 178

  Fly   182 -ETPSQQLALQEAAKASLKARRGRVRRGLNSLT-----TSDGTEKGGYICDVCGNFYEKRGRMME 240
             |..|:.:..::.:.:...::.|.....::.|.     ..|......::||.|...:.....:..
  Fly   179 SEPESEAIDNRDTSSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTR 243

  Fly   241 H------------------------RRRHDGIC------QYACELCDAKFQVREQLRKHMYSHTG 275
            |                        ...|...|      |:.|.:|.........|:.|:..|.|
  Fly   244 HCNMINLPLTHSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAG 308

  Fly   276 SKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKV-CDKAFAYAHSLTKHELIHSDI--KLYRC 337
            ::.:||..||..|:..:.|.||:..|...:||:|:. |.|.|.:..:.:.||.:|.|.  ::|:|
  Fly   309 TRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQC 373

  Fly   338 DYCNKDF----RLLHHMRQHEETKLH 359
            :||.|.:    ....|.:.|..|:.|
  Fly   374 EYCPKSYVTPSECRTHQKYHNLTRDH 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 17/77 (22%)
C2H2 Zn finger 225..245 CDD:275368 4/44 (9%)
COG5048 <250..369 CDD:227381 35/118 (30%)
C2H2 Zn finger 253..273 CDD:275368 4/20 (20%)
zf-H2C2_2 266..288 CDD:290200 8/22 (36%)
C2H2 Zn finger 281..301 CDD:275368 7/20 (35%)
zf-H2C2_2 294..318 CDD:290200 10/25 (40%)
C2H2 Zn finger 309..329 CDD:275368 6/21 (29%)
C2H2 Zn finger 337..353 CDD:275368 5/20 (25%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 16/75 (21%)
C2H2 Zn finger 228..254 CDD:275368 4/26 (15%)
C2H2 Zn finger 286..306 CDD:275368 4/20 (20%)
C2H2 Zn finger 314..334 CDD:275368 7/20 (35%)
C2H2 Zn finger 342..363 CDD:275368 6/21 (29%)
C2H2 Zn finger 373..393 CDD:275368 5/20 (25%)
C2H2 Zn finger 401..419 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C189683835
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1772
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
33.080

Return to query results.
Submit another query.