DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and topi

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_649945.1 Gene:topi FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster

Alignment Length:374 Identity:92/375 (25%)
Similarity:150/375 (40%) Gaps:90/375 (24%)


  Fly    38 LIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQ----------FREKALRK-QMEIEEY--CR 89
            :.:||..|.|::.:|..    .|.:|.:::|.|.:          |..:|:|. .:.:..|  |.
  Fly   372 IAELLVHSASHVAERRF----ECTACDIQMNTAKEASIHFQTDCIFMREAIRSLNVTLSRYFVCN 432

  Fly    90 ELGL-LDESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEYLEVDTSDQQ-ECIGD 152
            ...| ...:|::       .:.:|....|.         ....|.|.:..|..|..|.. |...|
  Fly   433 VCELKFANTDLL-------QEHRCTSFHYF---------PRLNENGKKLLLPCDFCDVNFEFAHD 481

  Fly   153 TIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKASLKARRGRVRRGLNSLTTSDG 217
            .:.:.|:.:            |..:|:.:||.:              ...||:|:          
  Fly   482 FLAHSEEKH------------LNKKKREKETRN--------------TGAGRIRQ---------- 510

  Fly   218 TEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYAC--ELCDAKFQVREQLRKHMYS-HTGSKPY 279
                 |:||:||..|.:...:.:|.|.|.|:..:.|  |.||.||.:|..|..|:.. |||.:||
  Fly   511 -----YLCDICGKSYTQSSHLWQHLRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPY 570

  Fly   280 KCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDF 344
            .|..|.::|...||...|..:|||.:.|.|:.|.|.|..|.:|..|:.||:..|.|.|.:|.|.|
  Fly   571 LCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTF 635

  Fly   345 RLL----HHMR-QHEETKLHQNAVMLAESMKVEMVAEQGGGNEIRIQAH 388
            |..    .|:| :|.....:...:|..:..::|..|.|      :.|:|
  Fly   636 RQRGDRDKHIRARHSHLDANSRLMMQMQKFQLETAAAQ------KAQSH 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 12/60 (20%)
C2H2 Zn finger 225..245 CDD:275368 7/20 (35%)
COG5048 <250..369 CDD:227381 44/127 (35%)
C2H2 Zn finger 253..273 CDD:275368 9/23 (39%)
zf-H2C2_2 266..288 CDD:290200 9/23 (39%)
C2H2 Zn finger 281..301 CDD:275368 6/20 (30%)
zf-H2C2_2 294..318 CDD:290200 9/24 (38%)
C2H2 Zn finger 309..329 CDD:275368 8/20 (40%)
C2H2 Zn finger 337..353 CDD:275368 7/21 (33%)
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368 4/29 (14%)
COG5048 <450..647 CDD:227381 68/247 (28%)
C2H2 Zn finger 469..490 CDD:275368 5/21 (24%)
zf-C2H2 511..533 CDD:278523 8/22 (36%)
C2H2 Zn finger 513..564 CDD:275368 18/51 (35%)
C2H2 Zn finger 541..561 CDD:275368 9/20 (45%)
zf-H2C2_2 555..581 CDD:290200 10/26 (38%)
C2H2 Zn finger 572..592 CDD:275368 6/20 (30%)
zf-H2C2_2 585..609 CDD:290200 9/24 (38%)
zf-C2H2 598..620 CDD:278523 9/22 (41%)
C2H2 Zn finger 600..620 CDD:275368 8/20 (40%)
zf-H2C2_2 612..637 CDD:290200 11/25 (44%)
C2H2 Zn finger 628..646 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.