DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and CG17612

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster

Alignment Length:415 Identity:86/416 (21%)
Similarity:149/416 (36%) Gaps:96/416 (23%)


  Fly     9 TCRVCLAQSERLQRL-DEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQ 72
            :|||||.||:.|..: |:..:.|..... :|.|..|:.   :...:...:.||.:|...:..|:.
  Fly   186 SCRVCLEQSDNLTNIFDDAHQYGIPIAT-ILSQYTGMP---VEKGDSFSEYICVTCLDVVKNAFD 246

  Fly    73 FREKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQ----------QCDEEMYILEETTTGEE 127
            ..|.   |:..|:.|.:....:.:.|.:.:|.:....:          ||.:...:..:......
  Fly   247 DLES---KENTIQMYRQPKEEIIDIDSIPVKNKPVDYEVTGKPPHRCPQCPKIFLLAAKLQAHIR 308

  Fly   128 EHQEEKGHEE-----------YLEVDTSDQQECIGDTIEYLEDNYTIEMNSDQTEIVLESEKQYE 181
            .|.|.:..|.           |:      ::.|       ||.:..|...||:.|..||...:..
  Fly   309 THNETRTTEPPRLKCPMCPSIYM------KRGC-------LEAHMWIHRASDERESELEPPYRCP 360

  Fly   182 ETP-----SQQLALQEAAKASLKARRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEH 241
            ..|     |..|.:.......:..|..|               |..:.|..|.:.:.....:.:|
  Fly   361 HCPKLFLYSSFLEIHIQTHEDVSQRLSR---------------KSSHKCAQCADVFSDVSSLKDH 410

  Fly   242 RRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSH-ENVHRGIK 305
            .:.|.|...:.|.||...||....|:.|..:||   .:||..||:.|..::.|..| :..|....
  Fly   411 VKIHAGERTFKCPLCLMSFQEESNLKSHDCAHT---RFKCHKCSKFFESQNYLDFHFKKSHTTKG 472

  Fly   306 PYVCKVCDKAFAYAHSLTKHELIHSDI-----------KLYRCDYCNKDFRL-----LHH----- 349
            |:.|..|.:.|...:.|.:|  |.|.:           :::.|..|.|.|.:     :||     
  Fly   473 PFKCIKCQQTFQKRNGLKEH--ISSQVCVQFLRSKSPGQIFPCPKCPKKFSIEDNYQMHHATHKK 535

  Fly   350 ----MRQHEET---KLHQNAVMLAE 367
                :.:|..|   |.:||..:|.:
  Fly   536 VKTVIERHNCTQCKKSYQNKKLLTK 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 20/79 (25%)
C2H2 Zn finger 225..245 CDD:275368 3/20 (15%)
COG5048 <250..369 CDD:227381 37/148 (25%)
C2H2 Zn finger 253..273 CDD:275368 7/20 (35%)
zf-H2C2_2 266..288 CDD:290200 8/22 (36%)
C2H2 Zn finger 281..301 CDD:275368 6/21 (29%)
zf-H2C2_2 294..318 CDD:290200 7/25 (28%)
C2H2 Zn finger 309..329 CDD:275368 6/20 (30%)
C2H2 Zn finger 337..353 CDD:275368 6/30 (20%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 17/63 (27%)
C2H2 Zn finger 290..310 CDD:275368 2/20 (10%)
C2H2 Zn finger 323..343 CDD:275370 5/33 (15%)
zf-C2H2_8 356..438 CDD:292531 17/97 (18%)
C2H2 Zn finger 359..379 CDD:275368 3/20 (15%)
C2H2 Zn finger 394..414 CDD:275368 3/20 (15%)
C2H2 Zn finger 422..438 CDD:275368 6/16 (38%)
C2H2 Zn finger 447..463 CDD:275368 5/16 (31%)
C2H2 Zn finger 476..505 CDD:275368 7/31 (23%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
C2H2 Zn finger 545..565 CDD:275368 5/17 (29%)
C2H2 Zn finger 568..584 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.