DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and CG3407

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_608809.1 Gene:CG3407 FlyBaseID:FBgn0031573 Length:714 Species:Drosophila melanogaster

Alignment Length:429 Identity:92/430 (21%)
Similarity:161/430 (37%) Gaps:105/430 (24%)


  Fly    14 LAQSERLQ----RLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAY--Q 72
            |:..::||    :||::.::         :||...::.|::  .|:.|    ...|.:||..  |
  Fly   218 LSAQDKLQQEQAKLDQVFQD---------VQLNFENFHNIS--HHVND----VANVGVNMVLHGQ 267

  Fly    73 FREKALRKQMEIEEYCRELGLLDE---SD-------VMMIKEEDGSQQQCDEEMYILEETTTG-- 125
            ..:|.....:........:.::|:   ||       :..:.::...:..|| |:..||.|::|  
  Fly   268 ATDKLNAVVVNTSSTPNSVPVVDDVEFSDTEDMLEGIRNVVDKVSIEDTCD-ELVDLELTSSGMT 331

  Fly   126 -----------------------------------EEEHQEEKGHEEYLEVDTSDQQE------C 149
                                               |..|..:....::|..:.:|.||      .
  Fly   332 APWFNNNFRDITFPALLLPGEPPPASSEPATPLLKENPHVGDHMALDFLSPEKADPQEEAKLEKT 396

  Fly   150 IGDTIEYLEDNYTIEMNSDQT---EIVLESEKQYEETPSQQLALQEAAK------------ASLK 199
            :....|..|....:...:.||   ..|..:....|:.....|.|.||.|            :|.:
  Fly   397 LSKACEPNEQTLLVAPPACQTPPIPTVPPANSSIEQLRRSPLELSEAFKLEEDDMTDSRPASSFE 461

  Fly   200 -----ARRGRVRRGLNSLTTS-----DGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACE 254
                 |........:..|.||     :...:..:.||.|...:.....:..|:..|:....:.|:
  Fly   462 EGDPDAEEPNECFQMEVLDTSLTEEAENKTRRKHFCDKCNRDFNSYNALKYHQYTHNQERSHKCD 526

  Fly   255 LCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSH-ENVHRGIKPYVCKVCDKAFAY 318
            .|:..|..:..|:.|..:|:|.||:||..|..||.....||.| .:.|..:|.::|:.|.|:|:.
  Fly   527 SCERSFYTQSALKAHERTHSGVKPFKCDKCEFQFRQWGDLKYHIISRHSDVKAHMCEFCGKSFSR 591

  Fly   319 AHSLTKHELIHSDIKLYRCDYCNKDFR----LLHHMRQH 353
            .:||..|..||:..|.|.|.||:|.||    ||.|::.|
  Fly   592 RYSLVVHRRIHTREKNYACQYCDKTFRASSYLLSHIKVH 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 15/79 (19%)
C2H2 Zn finger 225..245 CDD:275368 4/20 (20%)
COG5048 <250..369 CDD:227381 40/110 (36%)
C2H2 Zn finger 253..273 CDD:275368 5/20 (25%)
zf-H2C2_2 266..288 CDD:290200 10/22 (45%)
C2H2 Zn finger 281..301 CDD:275368 7/21 (33%)
zf-H2C2_2 294..318 CDD:290200 9/25 (36%)
C2H2 Zn finger 309..329 CDD:275368 8/20 (40%)
C2H2 Zn finger 337..353 CDD:275368 9/20 (45%)
CG3407NP_608809.1 COG5048 <494..656 CDD:227381 45/138 (33%)
C2H2 Zn finger 497..517 CDD:275368 4/20 (20%)
zf-H2C2_2 509..534 CDD:290200 5/25 (20%)
C2H2 Zn finger 525..545 CDD:275368 5/20 (25%)
zf-H2C2_2 537..562 CDD:290200 11/25 (44%)
C2H2 Zn finger 555..574 CDD:275371 6/19 (32%)
zf-C2H2 580..602 CDD:278523 8/22 (36%)
C2H2 Zn finger 582..602 CDD:275368 8/20 (40%)
zf-H2C2_2 594..617 CDD:290200 11/23 (48%)
C2H2 Zn finger 610..630 CDD:275368 9/20 (45%)
zf-H2C2_2 622..645 CDD:290200 4/10 (40%)
zf-C2H2 636..658 CDD:278523
C2H2 Zn finger 638..658 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.