DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and CG8944

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_573065.1 Gene:CG8944 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster

Alignment Length:340 Identity:72/341 (21%)
Similarity:115/341 (34%) Gaps:119/341 (35%)


  Fly    10 CRVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHIPDGICKSCKVELNMAYQFR 74
            |.:|..|....|..|          |...:.|.||:....|         |:.|..      .||
  Fly   506 CNICSIQFHNAQEFD----------NHKQLHLGGVTEIKFN---------CELCTA------SFR 545

  Fly    75 EKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEYL 139
            |||     ..:|:.|                     :.:||:::                  ..|
  Fly   546 EKA-----NYDEHLR---------------------RHNEELFL------------------PSL 566

  Fly   140 EVDTSDQQECIGDTIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKASLKARRGR 204
            .::.|..:..:||                 .||.:|.|              |:..:..:.:|..
  Fly   567 ALNHSIMEGGLGD-----------------DEIGVEGE--------------ESRGSGSRRKRRH 600

  Fly   205 VRRGLNSLTTSD---------GTEKGG------YICDVCGNFYEKRGRMMEHRRRHDGICQ--YA 252
            ..:..:.:...|         |:..||      |.||||...:...|.:..||..|....:  |.
  Fly   601 AAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQDERERCYK 665

  Fly   253 CEL--CDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKA 315
            |:.  |:..|..|..|.:|:..|..::.:||..|.:.|.....|::|:.:|..||.|||::|..|
  Fly   666 CDYPQCNKSFVARNSLFEHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKRYVCQICGSA 730

  Fly   316 FAYAHSLTKHELIHS 330
            ||.|..|..|:..|:
  Fly   731 FAQAAGLYLHKRRHN 745

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 18/77 (23%)
C2H2 Zn finger 225..245 CDD:275368 7/20 (35%)
COG5048 <250..369 CDD:227381 28/86 (33%)
C2H2 Zn finger 253..273 CDD:275368 6/22 (27%)
zf-H2C2_2 266..288 CDD:290200 6/22 (27%)
C2H2 Zn finger 281..301 CDD:275368 5/20 (25%)
zf-H2C2_2 294..318 CDD:290200 12/24 (50%)
C2H2 Zn finger 309..329 CDD:275368 8/20 (40%)
C2H2 Zn finger 337..353 CDD:275368
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738
C2H2 Zn finger 476..496 CDD:275368
C2H2 Zn finger 506..526 CDD:275368 6/30 (20%)
C2H2 Zn finger 537..557 CDD:275368 9/52 (17%)
C2H2 Zn finger 636..656 CDD:275368 7/20 (35%)
zf-C2H2_8 639..712 CDD:292531 18/73 (25%)
C2H2 Zn finger 666..688 CDD:275368 6/22 (27%)
zf-C2H2 694..716 CDD:278523 6/22 (27%)
C2H2 Zn finger 696..716 CDD:275368 5/20 (25%)
zf-H2C2_2 708..733 CDD:290200 12/25 (48%)
C2H2 Zn finger 724..744 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.