DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and CG2129

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster

Alignment Length:370 Identity:81/371 (22%)
Similarity:131/371 (35%) Gaps:130/371 (35%)


  Fly   110 QQCDEEMYILEETTTGEEE-----------HQ----EEKGHEEYLEVD----TSDQQECIGDTIE 155
            :..|:|..:||:....|:|           ||    |.......|:||    .|:|:||      
  Fly   105 EDSDDERVVLEKQDEDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEEDSEQEEC------ 163

  Fly   156 YLEDNYTIEMNSD------------------QTEIVLESE--KQYEET-------------PSQQ 187
                ...::::|:                  |:..|||..  :|:::|             |.:.
  Fly   164 ----GMELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKD 224

  Fly   188 LALQEAAKASLKARRGRVRRGLNSLTT------SDGTE--------------------------- 219
            ..::.||:.......|::..|..||..      .:|.|                           
  Fly   225 APVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQ 289

  Fly   220 -KGGYICDVCGNFYEKRGRMMEHRRRHDGI---------C---------------------QYAC 253
             .||..|.|||..|:.|..:..|:.:|...         |                     .:.|
  Fly   290 AHGGAACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNHGKVHTEQKNFVC 354

  Fly   254 ELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAY 318
            |.|....:.:|.||.|:.||||.:|:.|..|.::|...|.|:.|..:|...:|:||.||...|:.
  Fly   355 ESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSR 419

  Fly   319 AHSLTKHELIHSDIKLYRCDYCNKDFR----LLHHMRQHEETKLH 359
            ...|..|:.:|:|.|.:.|..|...:.    |..|||:|...:|:
  Fly   420 QKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRKHRNDELN 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071
C2H2 Zn finger 225..245 CDD:275368 7/20 (35%)
COG5048 <250..369 CDD:227381 38/115 (33%)
C2H2 Zn finger 253..273 CDD:275368 8/20 (40%)
zf-H2C2_2 266..288 CDD:290200 10/22 (45%)
C2H2 Zn finger 281..301 CDD:275368 6/20 (30%)
zf-H2C2_2 294..318 CDD:290200 9/24 (38%)
C2H2 Zn finger 309..329 CDD:275368 6/20 (30%)
C2H2 Zn finger 337..353 CDD:275368 6/20 (30%)
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 7/20 (35%)
zf-C2H2_8 323..411 CDD:292531 23/88 (26%)
C2H2 Zn finger 327..346 CDD:275368 1/19 (5%)
C2H2 Zn finger 354..374 CDD:275368 8/20 (40%)
zf-H2C2_2 367..389 CDD:290200 10/22 (45%)
C2H2 Zn finger 382..402 CDD:275368 6/20 (30%)
zf-H2C2_2 395..419 CDD:290200 9/24 (38%)
C2H2 Zn finger 410..430 CDD:275368 6/20 (30%)
C2H2 Zn finger 438..458 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.