DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and Zfp810

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_011240774.1 Gene:Zfp810 MGIID:2384563 Length:466 Species:Mus musculus

Alignment Length:361 Identity:96/362 (27%)
Similarity:140/362 (39%) Gaps:58/362 (16%)


  Fly    28 EEGEESPNEMLIQLLGVSYSNLNDREHIPDGI----CKSCKVELNMAYQFREKALRKQMEIE--- 85
            |....:.||.|:: :|...:.|...|.|..|.    |:.|.....:..|:..|......|..   
Mouse    98 EINSHTANEELVE-VGKIDAELKIHEEIHRGAKSYECEVCLEAFYLKPQYSTKQSYHTCENPCDC 161

  Fly    86 EYCREL----GLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEHQEEKGHE---------- 136
            :.|||.    ..|.:...:...|:..:..:|.:..|.....|..:..|..||.::          
Mouse   162 KKCREAFYPKSTLSQYQRLERGEKPHACLECGKSFYCKSHLTVHQRTHTGEKPYDCKECRKAFYS 226

  Fly   137 -----EYLEVDTSDQ-QECIGDTIEYLEDNYTIEMNSDQT--EIVLESEKQYEETPSQQLALQEA 193
                 .:|.:.|.:: .||       .:.......|||.|  :.....||.||            
Mouse   227 KSQLNVHLRIHTGEKPYEC-------KDCRKAFYRNSDLTVHQRTHTGEKPYE------------ 272

  Fly   194 AKASLKARRGRVRRGLNS-LTTSDGTEKG--GYICDVCGNFYEKRGRMMEHRRRHDGICQYACEL 255
            .|...||..      .|| ||....|..|  .|.|.||...:..:.::..|.|.|.|...|.|:.
Mouse   273 CKVCRKAFY------CNSQLTVHHRTHTGEKPYECQVCNKAFYCKSQLAVHHRTHTGEKPYQCKE 331

  Fly   256 CDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAH 320
            |...||.|..|.:|..:|||.:||:|..|.:.|:.:|.|..|:..|.|.|||.||.|.|||....
Mouse   332 CRKAFQCRSDLTRHQRTHTGERPYECPECRKAFYRKSDLTVHQRTHTGEKPYECKECRKAFYCNS 396

  Fly   321 SLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQHEET 356
            .||.|:..|:..|.|.|..|.|.|:..:.:.:|:.|
Mouse   397 QLTVHQRQHTGEKPYECKDCGKAFQCKYELTRHQRT 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 14/66 (21%)
C2H2 Zn finger 225..245 CDD:275368 5/20 (25%)
COG5048 <250..369 CDD:227381 42/108 (39%)
C2H2 Zn finger 253..273 CDD:275368 7/20 (35%)
zf-H2C2_2 266..288 CDD:290200 9/22 (41%)
C2H2 Zn finger 281..301 CDD:275368 6/20 (30%)
zf-H2C2_2 294..318 CDD:290200 13/24 (54%)
C2H2 Zn finger 309..329 CDD:275368 9/20 (45%)
C2H2 Zn finger 337..353 CDD:275368 4/16 (25%)
Zfp810XP_011240774.1 KRAB 4..59 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 133..153 CDD:275368 4/20 (20%)
C2H2 Zn finger 161..181 CDD:275368 4/20 (20%)
C2H2 Zn finger 189..209 CDD:275368 3/20 (15%)
COG5048 <199..373 CDD:227381 51/199 (26%)
zf-H2C2_2 201..224 CDD:290200 4/23 (17%)
C2H2 Zn finger 217..237 CDD:275368 1/20 (5%)
zf-H2C2_2 230..254 CDD:290200 4/31 (13%)
C2H2 Zn finger 245..265 CDD:275368 5/27 (19%)
zf-H2C2_2 257..280 CDD:290200 9/35 (26%)
C2H2 Zn finger 273..293 CDD:275368 8/26 (31%)
zf-H2C2_2 286..308 CDD:290200 8/22 (36%)
C2H2 Zn finger 301..321 CDD:275368 5/20 (25%)
zf-H2C2_2 314..336 CDD:290200 7/22 (32%)
C2H2 Zn finger 329..349 CDD:275368 7/20 (35%)
zf-H2C2_2 341..366 CDD:290200 10/25 (40%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
zf-H2C2_2 369..392 CDD:290200 12/23 (52%)
C2H2 Zn finger 385..405 CDD:275368 9/20 (45%)
zf-H2C2_2 398..420 CDD:290200 9/22 (41%)
C2H2 Zn finger 413..433 CDD:275368 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.