DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and Zfp369

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_848141.3 Gene:Zfp369 MGIID:2176229 Length:845 Species:Mus musculus

Alignment Length:291 Identity:73/292 (25%)
Similarity:110/292 (38%) Gaps:61/292 (21%)


  Fly   125 GEEEHQEEKGHEEYLEVDTSDQQECIGDTIEYLEDNY---------------TIEMNSDQTEIVL 174
            |.|.|:..|.:...|: .:|.|...:|.......||.               .|:.|::..:.|.
Mouse   548 GPEWHKAGKSNNSMLQ-GSSAQNHQMGSRAGRARDNSILTHVKIHQKGYKEGKIQGNNNYLKHVK 611

  Fly   175 ESEKQYEETPSQQLA------------LQEAAK-------ASLK-----------ARRGRVRRGL 209
            ..:|..:|...::|:            |:.:.:       ||:|           :..||:||..
Mouse   612 PHQKGSKEERLRELSTCQKHVPYVKQHLKTSGRGKGRKINASIKCGPYIKTYYRGSDVGRLRRAN 676

  Fly   210 NSLTTSD---------GTEKGGYICDV--CGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVR 263
            |......         ...||..||..  ||..:........|::.|.|...|.|..|...|...
Mouse   677 NCRKAISRHAQQISFIKIHKGSQICQCSECGKMFRNARYFSVHKKIHTGERPYMCMSCGKAFVQS 741

  Fly   264 EQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELI 328
            ..|.:|:..|:|.:|::||.|.|.|...|....|...|.|.|||.|:.|.|||..:..||:|..|
Mouse   742 SSLTQHLRIHSGERPFECSECGRTFSDRSAASQHLRTHTGAKPYQCQHCGKAFRQSSHLTRHVRI 806

  Fly   329 HSDIKLYRCDYCNKDF----RLLHHMRQHEE 355
            |:..:.|.|..|.|.|    .|:.|.:.|.:
Mouse   807 HTGERPYVCTKCGKAFTQSSNLIGHQKTHRK 837

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071
C2H2 Zn finger 225..245 CDD:275368 4/22 (18%)
COG5048 <250..369 CDD:227381 39/111 (35%)
C2H2 Zn finger 253..273 CDD:275368 5/20 (25%)
zf-H2C2_2 266..288 CDD:290200 9/22 (41%)
C2H2 Zn finger 281..301 CDD:275368 7/20 (35%)
zf-H2C2_2 294..318 CDD:290200 11/24 (46%)
C2H2 Zn finger 309..329 CDD:275368 9/20 (45%)
C2H2 Zn finger 337..353 CDD:275368 6/20 (30%)
Zfp369NP_848141.3 KRAB 35..94 CDD:214630
KRAB 35..74 CDD:279668
SCAN 179..266 CDD:280241
KRAB 300..>340 CDD:214630
KRAB 300..339 CDD:279668
C2H2 Zn finger 676..695 CDD:275370 1/19 (5%)
C2H2 Zn finger 703..723 CDD:275368 3/20 (15%)
zf-H2C2_2 715..740 CDD:290200 7/25 (28%)
COG5048 727..>792 CDD:227381 23/65 (35%)
C2H2 Zn finger 731..751 CDD:275368 5/20 (25%)
zf-H2C2_2 743..767 CDD:290200 10/24 (42%)
zf-C2H2 757..779 CDD:278523 7/22 (32%)
C2H2 Zn finger 759..779 CDD:275368 7/20 (35%)
zf-C2H2 785..807 CDD:278523 10/22 (45%)
C2H2 Zn finger 787..807 CDD:275368 9/20 (45%)
zf-H2C2_2 799..824 CDD:290200 10/25 (40%)
C2H2 Zn finger 815..835 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4800
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.