DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and ZNF98

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001092096.1 Gene:ZNF98 HGNCID:13174 Length:572 Species:Homo sapiens

Alignment Length:291 Identity:84/292 (29%)
Similarity:134/292 (46%) Gaps:37/292 (13%)


  Fly    75 EKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEYL 139
            :|..|:.:::.:||:.   :||..|.  ||......||        .|||..:..|.:|..:.:.
Human   113 KKCGRENLQLRKYCKS---MDECKVH--KECYNGLNQC--------LTTTQNKIFQYDKYVKVFH 164

  Fly   140 EVDTSDQQECIGDT------IEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKASL 198
            :...|::.: ||.|      .:..|.::.:..:..|.:.:...||.|:        .:|..||..
Human   165 KFSNSNRHK-IGHTGKKSFKCKECEKSFCMLSHLAQHKRIHSGEKPYK--------CKECGKAYN 220

  Fly   199 KARRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVR 263
            :|......:.::       |.|..|.|:.||..:.:...:..|:..|.|...|.||.|...|...
Human   221 EASNLSTHKRIH-------TGKKPYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQS 278

  Fly   264 EQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELI 328
            ..|..|...|||.|||||..|.|.|...|.|.:|:.:|.|.|||.|:.|.|||:.:.:||.|::|
Human   279 ANLTTHKRIHTGEKPYKCEECGRAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHKII 343

  Fly   329 HSDIKLYRCDYCNKDFRLLHHMRQHEETKLH 359
            |:..|.|:|:.|.|.|..|.|:..|:  ::|
Human   344 HTGEKFYKCEECGKAFSRLSHLTTHK--RIH 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 2/12 (17%)
C2H2 Zn finger 225..245 CDD:275368 4/20 (20%)
COG5048 <250..369 CDD:227381 46/111 (41%)
C2H2 Zn finger 253..273 CDD:275368 6/20 (30%)
zf-H2C2_2 266..288 CDD:290200 12/22 (55%)
C2H2 Zn finger 281..301 CDD:275368 7/20 (35%)
zf-H2C2_2 294..318 CDD:290200 12/24 (50%)
C2H2 Zn finger 309..329 CDD:275368 9/20 (45%)
C2H2 Zn finger 337..353 CDD:275368 6/16 (38%)
ZNF98NP_001092096.1 KRAB 13..73 CDD:214630
KRAB 13..52 CDD:279668
COG5048 179..563 CDD:227381 64/212 (30%)
C2H2 Zn finger 184..204 CDD:275368 2/20 (10%)
zf-H2C2_2 196..220 CDD:290200 7/32 (22%)
C2H2 Zn finger 212..232 CDD:275368 4/20 (20%)
zf-H2C2_2 224..249 CDD:290200 6/32 (19%)
C2H2 Zn finger 240..260 CDD:275368 4/20 (20%)
zf-H2C2_2 252..277 CDD:290200 8/25 (32%)
C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
zf-H2C2_2 280..305 CDD:290200 13/25 (52%)
C2H2 Zn finger 296..316 CDD:275368 7/20 (35%)
C2H2 Zn finger 324..344 CDD:275368 9/20 (45%)
zf-H2C2_2 337..361 CDD:290200 11/24 (46%)
zf-C2H2 350..372 CDD:278523 8/24 (33%)
C2H2 Zn finger 352..372 CDD:275368 7/22 (32%)
zf-H2C2_2 364..389 CDD:290200 3/12 (25%)
C2H2 Zn finger 380..400 CDD:275368
C2H2 Zn finger 408..428 CDD:275368
zf-H2C2_2 420..444 CDD:290200
C2H2 Zn finger 436..456 CDD:275368
zf-H2C2_2 449..473 CDD:290200
C2H2 Zn finger 464..484 CDD:275368
zf-H2C2_2 477..501 CDD:290200
C2H2 Zn finger 492..512 CDD:275368
zf-H2C2_2 504..529 CDD:290200
C2H2 Zn finger 520..540 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.