DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zif and LOC108348145

Sequence 1:NP_001189188.1 Gene:Zif FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006241989.1 Gene:LOC108348145 RGDID:11394947 Length:670 Species:Rattus norvegicus

Alignment Length:509 Identity:113/510 (22%)
Similarity:175/510 (34%) Gaps:152/510 (30%)


  Fly     3 VELTPQTCRVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHI-------PDGIC 60
            |:.|.:.|.||......:..||.....|:|.|..  .|....:.|:....:|.       |.| |
  Rat   175 VKGTSENCEVCGRVVRPVLNLDPYEMNGQERPYR--CQECQETSSDCKQEKHTGDCHGKKPYG-C 236

  Fly    61 KSCK------------------------VELNMAYQFREKALRKQM----EIEEYCRELGLLDES 97
            :.|.                        |:....::...|.::.|.    |....|.|.|.....
  Rat   237 EECGKVFRLCSQLNQHQRIHTGEKPFKCVDCGKGFRLSSKLIQHQRIHTGEKPYRCEECGKTFGQ 301

  Fly    98 DVMMIK-------EEDGSQQQC------DEEMYILEETTTGEEEHQ-EEKG-----------HEE 137
            ...:|.       |...|.|:|      ..::...:.|.|||..:. :|.|           |:.
  Rat   302 SSSLIHHQRIHTGERPYSCQECGKSFSQQSQLVRHQRTHTGERPYPCQECGKAFSQSSTLAQHQR 366

  Fly   138 YLEVDTSDQQECIGD-TIEYLEDNYTIE---------------MNSDQTEIVLESEKQYE----- 181
            ....:.|......|. ::...:.|.|:|               ...:|.:::...||.|:     
  Rat   367 MHTGEKSQMPRASGSPSLLARQRNNTVEKPFKCEECGKAFRWISRLNQHQLIHTGEKPYKCNKCT 431

  Fly   182 ---------------ETPSQQLALQEAAKASLKA----RRGRVRRGLNSLTTSDGTEKGGYICDV 227
                           .|..:....:|..|..::.    :..|:..|          || .|:||.
  Rat   432 KAFGCSSRLIRHQRTHTGEKPFKCEECGKGFVQGSHLIQHQRIHTG----------EK-PYVCDD 485

  Fly   228 CGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYES 292
            ||..:.:...::.|:|.|.|...|.|..|...|.:..||..|...|||.:|||||.|.:.|...|
  Rat   486 CGKAFSQSSSLIYHQRIHKGEKPYECIQCGKAFSMSTQLTSHQRIHTGERPYKCSECGKAFSQNS 550

  Fly   293 VLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDI------------------------- 332
            .|..|:.:|.|:|||.|..|.|||:.:..|.:|:.||:..                         
  Rat   551 TLFQHQIIHAGVKPYECSECGKAFSRSSYLIEHQRIHTRAQWYYEFGNTTESSTFLNHKKVNPVK 615

  Fly   333 KLYRCDYCNKDFR----LLHHMRQHEETKLHQ-NAV--------MLAESMKVEM 373
            ||::||.|:|.||    |:.|.|.|...|.:: ||.        .|.:..|:.|
  Rat   616 KLHQCDDCDKIFRWRSHLVIHQRIHTGEKPYRCNACGKAFNRSSRLTQHQKIHM 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 19/113 (17%)
C2H2 Zn finger 225..245 CDD:275368 6/20 (30%)
COG5048 <250..369 CDD:227381 50/157 (32%)
C2H2 Zn finger 253..273 CDD:275368 6/20 (30%)
zf-H2C2_2 266..288 CDD:290200 11/22 (50%)
C2H2 Zn finger 281..301 CDD:275368 7/20 (35%)
zf-H2C2_2 294..318 CDD:290200 12/24 (50%)
C2H2 Zn finger 309..329 CDD:275368 8/20 (40%)
C2H2 Zn finger 337..353 CDD:275368 9/20 (45%)
LOC108348145XP_006241989.1 KRAB 4..64 CDD:214630
KRAB 4..41 CDD:279668
C2H2 Zn finger 236..256 CDD:275368 2/20 (10%)
zf-H2C2_2 249..271 CDD:290200 1/22 (5%)
C2H2 Zn finger 264..284 CDD:275368 3/20 (15%)
zf-H2C2_2 277..299 CDD:290200 5/22 (23%)
C2H2 Zn finger 292..312 CDD:275368 4/20 (20%)
zf-H2C2_2 304..329 CDD:290200 5/25 (20%)
COG5048 316..659 CDD:227381 84/354 (24%)
zf-C2H2 318..340 CDD:278523 4/22 (18%)
C2H2 Zn finger 320..340 CDD:275368 3/20 (15%)
zf-H2C2_2 333..357 CDD:290200 6/24 (25%)
C2H2 Zn finger 348..368 CDD:275368 3/20 (15%)
C2H2 Zn finger 399..419 CDD:275368 1/20 (5%)
zf-H2C2_2 412..434 CDD:290200 4/22 (18%)
C2H2 Zn finger 427..447 CDD:275368 0/20 (0%)
zf-H2C2_2 440..464 CDD:290200 3/24 (13%)
C2H2 Zn finger 455..475 CDD:275368 3/20 (15%)
zf-H2C2_2 467..492 CDD:290200 9/36 (25%)
C2H2 Zn finger 483..503 CDD:275368 6/20 (30%)
zf-H2C2_2 495..519 CDD:290200 8/24 (33%)
C2H2 Zn finger 511..531 CDD:275368 6/20 (30%)
zf-H2C2_2 524..548 CDD:290200 12/24 (50%)
C2H2 Zn finger 539..559 CDD:275368 7/20 (35%)
zf-C2H2 565..587 CDD:278523 9/22 (41%)
C2H2 Zn finger 567..587 CDD:275368 8/20 (40%)
C2H2 Zn finger 620..640 CDD:275368 9/20 (45%)
zf-H2C2_2 632..657 CDD:290200 7/25 (28%)
C2H2 Zn finger 648..668 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.