DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18048 and TRM13

Sequence 1:NP_649646.3 Gene:CG18048 FlyBaseID:FBgn0037435 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_014516.1 Gene:TRM13 SGDID:S000005485 Length:476 Species:Saccharomyces cerevisiae

Alignment Length:491 Identity:159/492 (32%)
Similarity:227/492 (46%) Gaps:102/492 (21%)


  Fly    11 VKAEKP-VTTTCSYWVLRKKRRCKMTANKGSEFCGAHAS---SAATTATCDEKARE-DSFQERIP 70
            ||..|| ....|.|::.:|||||.||.:..:.:|..|.:   .||.:...::...| :..:||:|
Yeast    10 VKRAKPSERLQCEYFMEKKKRRCGMTRSSQNLYCSEHLNLMKKAANSQVHNKNGSEAEKERERVP 74

  Fly    71 CPLDHKHTVFKRKLAKHLTICNARDQESSL----PYIVKGVNSGDNLKETDEDLNKFNQIKLHEL 131
            ||||..|||:..:|.|||..|| :.:.|.|    ||...|.|..:.|..        :.:|:...
Yeast    75 CPLDPNHTVWADQLKKHLKKCN-KTKLSHLNDDKPYYEPGYNGENGLLS--------SSVKIDIT 130

  Fly   132 ADEEFYSLIDKVKNLYDKHINSSIQELQLEHESLKEELSRKDYGQ--ETLRQLTQTTSLL----- 189
            |:.    |:..::.||......|:.||.|...:.| .:|.|.:.|  ...:...|.:||:     
Yeast   131 AEH----LVQSIELLYKVFEGESMDELPLRQLNNK-LMSLKRFPQLPSNTKHAVQQSSLIENLVD 190

  Fly   190 -GILEHDHQLMDHTSYIEFGAGKGQ----LAYFLATVLQEQKLSHS-----QVVLIDRMSLRHKK 244
             |..|....|    ::||||.|:.:    ::.:|.|.|......||     :.|||||.:.|.|.
Yeast   191 AGAFERPESL----NFIEFGCGRAEFSRYVSLYLLTQLTSLPAEHSGSNSNEFVLIDRATNRMKF 251

  Fly   245 DNKLAN--REV-------------VQRIRADIADLKLSALPELKKTQ----RTVAFSKHLCGAAT 290
            |.|:.:  .|:             ::||:.||.|||:.  |.||.|.    :.|..||||||.||
Yeast   252 DKKIKDDFSEIKSNSPSKPISCPSIKRIKIDIRDLKMD--PILKSTPGDDIQYVCISKHLCGVAT 314

  Fly   291 DLTLRCI------LGDGNASSD----YVLIALCCHHRCSWRSYVGR--------KFLQEAGIGPR 337
            |||||||      .||.|...:    .:.||:||.|.|.:..||.|        |:.....|...
Yeast   315 DLTLRCIGNSSILHGDDNNGCNPKLKAICIAMCCRHVCDYGDYVNRSYVTSLVEKYRAHGSILTY 379

  Fly   338 E--FVILTKMVSWAVCGTGLSRERRKAMESAD-------FQLTETNTQRLTRQEREQIGQQCKRV 393
            |  |.:|||:.||..||      |:......|       |:..|..|  :|.:|||.||...:||
Yeast   380 ETFFRVLTKLCSWGTCG------RKPGTAITDIVNVVESFEGAEPYT--ITIKERENIGLMARRV 436

  Fly   394 LDYGRLEHLRSH--GYQAELKFYVPRDVTLENVVLL 427
            :|.|||.:::..  .:.|||..||..||:||||.:|
Yeast   437 IDEGRLVYVKEKFTEFNAELIRYVESDVSLENVAML 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18048NP_649646.3 zf-TRM13_CCCH 20..44 CDD:288558 10/24 (42%)
zf-U11-48K 69..92 CDD:283028 13/23 (57%)
TRM13 183..429 CDD:282990 105/309 (34%)
TRM13NP_014516.1 zf-TRM13_CCCH 19..47 CDD:314564 11/28 (39%)
zf-U11-48K 73..96 CDD:310105 13/23 (57%)
TRM13 179..474 CDD:310074 105/309 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255223552
eggNOG 1 0.900 E1_KOG2811
Hieranoid 1 1.000
Homologene 1 1.000 H6875
Inparanoid 1 1.050 168 1.000 Inparanoid score I1011
Isobase 1 0.950 0 Normalized mean entropy S2977
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003971
OrthoInspector 1 1.000 T1136039
orthoMCL 1 0.900 OOG5_129749
Panther 1 1.100 LDO PTHR12998
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1546
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.