DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18048 and AT4G01880

Sequence 1:NP_649646.3 Gene:CG18048 FlyBaseID:FBgn0037435 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_192097.2 Gene:AT4G01880 AraportID:AT4G01880 Length:453 Species:Arabidopsis thaliana

Alignment Length:476 Identity:139/477 (29%)
Similarity:224/477 (47%) Gaps:79/477 (17%)


  Fly    14 EKPVTTTCSYWVLRKKRRCKMTANKGSEFCGAHASSAATTATCDEKAREDSFQERIPCPLDHKHT 78
            |...:..||:|:.:|||.|..|..:.|.|||.|:....              .:.||||:|..|:
plant     2 EAKSSNRCSFWLPKKKRSCANTRIESSMFCGNHSQRLE--------------GQWIPCPIDPSHS 52

  Fly    79 VFKRKLAKHLTICNARDQESSLP---YIVKGVNSGDNLKETDEDLNKFNQIK-------LHELAD 133
            |.:..|..|:..|....|...|.   :..||:|:|::  |.:|.:...:.:.       |:.::.
plant    53 VLQENLEWHVKRCPLLKQTVELSGQRFYQKGINAGND--EEEEKMGSCSLVTSEMKRNLLYSMSV 115

  Fly   134 EEFYSLIDKVKNLYDKHINSSIQELQLEHES----LKEELSRKDYGQETLRQLTQTTSLLGILEH 194
            .:|:.||.|:::::. .|...|::..|..|:    ..:|:.||...||  :.:.|..|:||.||.
plant   116 SKFHQLIKKIEDVHG-GICKDIEDSYLSPEACNIWFNKEIDRKLPFQE--KHVLQQGSILGNLEE 177

  Fly   195 DHQLM-----------------DHT--SYIEFGAGKGQLAYFLATVLQEQKLSHSQVVLIDRMSL 240
            ...|.                 |:|  :.:|||||:|.|...||.....:|     |.|::|.|.
plant   178 IGVLKRCNINVECCESDLEEKDDNTAPAVVEFGAGRGYLTQMLADCYGIKK-----VYLVERKSY 237

  Fly   241 RHKKDNKLANRE--VVQRIRADIADLKLSALPELKKTQRTVAFSKHLCGAATDLTLRCILGDGNA 303
            :.|.|..|..:|  |::|:|.||.||.|:|:..|.... .||..|||||.||||:|||.|...:.
plant   238 KLKADRSLRQKESLVLERMRIDIEDLNLNAVESLHGVP-YVAVGKHLCGPATDLSLRCCLSRQDG 301

  Fly   304 SSDY---VLIALCCHHRCSWRSYVGRKFLQEAGIGPREFVILTKMVSWAV--------------- 350
            .|..   :.||.||||...|:||:.::::...||...||.|:|...||||               
plant   302 ESPVLRGLAIATCCHHLSQWKSYINKEYILSLGISKDEFHIMTSFTSWAVDDDHGSKLPGVDDID 366

  Fly   351 -CGTGLSRERRKAMESADFQLTETNTQRLTRQEREQIGQQCKRVLDYGRLEHLRSHGYQAELKFY 414
             ..:....|....:..|.....|...:::...||..:|.:||:::|.||::.::.||..::|..|
plant   367 LLDSNAKEEEEGEVRDASLISVEEVVKKMKPMERAVLGFKCKQIIDAGRMKWVKKHGLNSKLVKY 431

  Fly   415 VPRDVTLENVVLLARPTSPKL 435
            :|..::.||.:|:|...:|.:
plant   432 IPASISPENTLLIAGKPNPSI 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18048NP_649646.3 zf-TRM13_CCCH 20..44 CDD:288558 11/24 (46%)
zf-U11-48K 69..92 CDD:283028 10/23 (43%)
TRM13 183..429 CDD:282990 92/286 (32%)
AT4G01880NP_192097.2 zf-TRM13_CCCH 7..34 CDD:288558 12/27 (44%)
zf-U11-48K 43..66 CDD:283028 10/23 (43%)
TRM13 166..445 CDD:282990 91/285 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6875
Inparanoid 1 1.050 188 1.000 Inparanoid score I1362
OMA 1 1.010
OrthoDB 1 1.010 D713196at2759
OrthoInspector 1 1.000 T192974
orthoMCL 1 0.900 OOG5_129749
Panther 1 1.100 LDO PTHR12998
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.