DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18048 and TRMT13

Sequence 1:NP_649646.3 Gene:CG18048 FlyBaseID:FBgn0037435 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_061956.2 Gene:TRMT13 HGNCID:25502 Length:481 Species:Homo sapiens

Alignment Length:483 Identity:147/484 (30%)
Similarity:249/484 (51%) Gaps:82/484 (17%)


  Fly    16 PVTTTCSYWVLRKKRRCKMTANKGSEFCGAHASSAATTATCDEKAREDSFQERIPCPLDHKHTVF 80
            |....|.|:|.:|||.|:|....|..|||.||.:          |.|:..::||.||||.||||:
Human    14 PAEGRCGYYVEKKKRFCRMVVAAGKRFCGEHAGA----------AEEEDARKRILCPLDPKHTVY 68

  Fly    81 KRKLAKHLTICNARDQESSLPYIVKGVNSGDNLKETDEDLNKFNQIKLHELADEEFYSLIDKVKN 145
            :.:|||||..||:|::... .:.::.:|:|  |::..|...:.  :.:..|::|:...||.|::.
Human    69 EDQLAKHLKKCNSREKPKP-DFYIQDINAG--LRDETEIPEQL--VPISSLSEEQLEKLIKKLRK 128

  Fly   146 LYDKHINSSIQELQLEHESLKEELSRKDYGQETLRQLTQTTSLLGILEHDHQLMDHTSYIEFGAG 210
            . .:.:||::::..:.|.:|.:.|:....|....:.|.|..|:||.:|:...|.....::|||||
Human   129 A-SEGLNSTLKDHIMSHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAG 192

  Fly   211 KGQLAYFLATVLQEQKLSHSQVVLIDRMSLRHKKDNKLANR-EVVQRIRADIADLKLSALPELKK 274
            ||:|::::...|::.:..|  .:|:::::.|.|.|.|...: .|.:|::.||..|.|:.:|.|::
Human   193 KGKLSHWVDIALKDAEKVH--FILVEKVTTRFKVDGKHRKKNSVFERLQIDIQHLCLNKIPVLRE 255

  Fly   275 TQ-RTVAFSKHLCGAATDLTLRCILGDGNASSDY------------------------------- 307
            .: ..|...|||||.||||.|||::....||.:.                               
Human   256 EKLPVVGIGKHLCGMATDLALRCLVETYAASFEERNEEPLAKRIKNDKTEKEIYTLAKEGNEKNV 320

  Fly   308 ---------VLIALCCHHRCSWRSYVGRKFLQEAGIGPREFVILTKMVSWAVCG-------TGLS 356
                     ::|||||||||.||.|||:::.:..|:|..||....:|.|||.||       |..|
Human   321 PEKWNPVAGIVIALCCHHRCDWRHYVGKEYFRALGLGAVEFHYFQRMSSWATCGMRKTSLETSNS 385

  Fly   357 RERRKAMESADFQLTETNTQRLTR------------QEREQIGQQCKRVLDYGRLEHLRSHGYQA 409
            ..:|:..::.|.:..:....|:|.            :|:::||..||.::|.||:::|:..|:..
Human   386 TTKRQDNQNDDSEEHDDGGYRITDDGADCLPGLLSVEEKKKIGHLCKLLIDQGRIQYLQQKGFSP 450

  Fly   410 ELKFYVPRDVTLENVVLLARP---TSPK 434
            .|::|....|:||||:|.|.|   :||:
Human   451 ALQYYTDPLVSLENVLLTALPNHSSSPE 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18048NP_649646.3 zf-TRM13_CCCH 20..44 CDD:288558 11/24 (46%)
zf-U11-48K 69..92 CDD:283028 15/23 (65%)
TRM13 183..429 CDD:282990 93/307 (30%)
TRMT13NP_061956.2 zf-TRM13_CCCH 17..45 CDD:288558 13/28 (46%)
zf-U11-48K 59..80 CDD:283028 14/21 (67%)
TRM13 165..469 CDD:282990 92/306 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255214344
eggNOG 1 0.900 E1_KOG2811
Hieranoid 1 1.000
Homologene 1 1.000 H6875
Inparanoid 1 1.050 231 1.000 Inparanoid score I3381
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D364329at33208
OrthoFinder 1 1.000 FOG0003971
OrthoInspector 1 1.000 T1073335
orthoMCL 1 0.900 OOG5_129749
Panther 1 1.100 LDO PTHR12998
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1546
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.