DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18048 and trmt13

Sequence 1:NP_649646.3 Gene:CG18048 FlyBaseID:FBgn0037435 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001014331.1 Gene:trmt13 ZFINID:ZDB-GENE-050327-19 Length:457 Species:Danio rerio

Alignment Length:471 Identity:166/472 (35%)
Similarity:247/472 (52%) Gaps:69/472 (15%)


  Fly     9 TTVKAEKPVTTTCSYWVLRKKRRCKMTANKGSEFCGAHASSAATTATCDEKAREDSFQERIPCPL 73
            :|.....|:...|:::|::|||.|||....|..|||.||:           |.|:..::||||||
Zfish     4 STADGAAPLPGRCAFYVVKKKRYCKMIVGSGKTFCGEHAN-----------AGEEGERKRIPCPL 57

  Fly    74 DHKHTVFKRKLAKHLTICNARDQESSLPYIVKGVNSGDNLKETDEDLNKFNQIKLHELADEEFYS 138
            |:|||||:..|.|||..||::::...: |.||.:|:|  ....||.:   .:|.:.:...||...
Zfish    58 DNKHTVFEDNLTKHLKKCNSKEKPKPI-YYVKDINAG--CASEDETV---KEISIADRTKEELDD 116

  Fly   139 LIDKVKNLYDKHINSSIQELQLEHESLKEELSRKDYGQETLRQLTQTTSLLGILEHDHQLMDHTS 203
            ||.|:||.. :.:|:.:.|..|.|.:|.|.|:....|....:.|.|..|:||.:|....|..:..
Zfish   117 LIVKLKNAL-QGLNTKLIENTLSHSALHESLNDPKNGDSAFKHLKQQASILGNMEALELLSPNRC 180

  Fly   204 YIEFGAGKGQLAYFLATVLQEQKLSHSQVVLIDRMSLRHKKDNKLANRE-VVQRIRADIADLKLS 267
            |||||||||:|::::...|:..:..|  .:|::|.|.|.|.|.|..|.: ...|::.||..|.|.
Zfish   181 YIEFGAGKGKLSHWIHIALKSAENVH--FLLVERSSTRFKVDGKHKNADSTFDRLQVDIQHLDLR 243

  Fly   268 ALPELK-KTQRTVAFSKHLCGAATDLTLRCIL--------------------GDGNASSDY---- 307
            .:|.|: |....:...||||||||||.|||:.                    .:|....|.    
Zfish   244 KVPLLREKGLPVIGVGKHLCGAATDLALRCLFEHNCTSKDDEPPFKRVKLNQAEGAGGKDMKPVP 308

  Fly   308 ---------------VLIALCCHHRCSWRSYVGRKFLQEAGIGPREFVILTKMVSWAVCG----- 352
                           :.|||||||||.||.|||::|.:|.|:||.||....:|.|||.||     
Zfish   309 STEGRETGKEIVVSGLAIALCCHHRCDWRHYVGKEFFRERGLGPEEFAAFQRMSSWATCGMRKAA 373

  Fly   353 ---TGLSRERRKAMESADFQLTETNTQRLTRQEREQIGQQCKRVLDYGRLEHLRSHGYQAELKFY 414
               :...|:..|..|.:|..:.:|....::.::|||||:.|||::|:||:.:|:..|::..:|:|
Zfish   374 ETTSEHKRDEEKEHEMSDEAVLDTLNGFMSVEDREQIGRLCKRLIDHGRVHYLQKKGFKTSMKYY 438

  Fly   415 VPRDVTLENVVLLARP 430
            ..|||:||||:|.|.|
Zfish   439 TSRDVSLENVLLAAIP 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18048NP_649646.3 zf-TRM13_CCCH 20..44 CDD:288558 11/24 (46%)
zf-U11-48K 69..92 CDD:283028 16/23 (70%)
TRM13 183..429 CDD:282990 105/295 (36%)
trmt13NP_001014331.1 zf-TRM13_CCCH 14..42 CDD:288558 13/28 (46%)
zf-U11-48K 53..76 CDD:283028 16/23 (70%)
TRM13 160..452 CDD:282990 104/294 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255210441
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6875
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D364329at33208
OrthoFinder 1 1.000 FOG0003971
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129749
Panther 1 1.100 LDO PTHR12998
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.